KEGG   Zea mays (maize): 103633227Help
Entry
103633227         CDS       T01088                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zma03016]
    103633227
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     103633227
Transfer RNA biogenesis [BR:zma03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103633227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_1 Kelch_5 Kelch_4 Kelch_6 Kelch_2 Kelch_3 MTS DNA_methylase Trm5_N Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 103633227
NCBI-ProteinID: XP_008653147
UniProt: A0A1D6ID10
Position
7
AA seq 1080 aa AA seqDB search
MDFGRRKAAALAALSSPTPDRSPKGGVDAPIAPLLDALNSHPDLFTTSSCSGRVSVLAQP
PPPHEGWGEGAPKPKKKARGGGWVYVSHDPADPDAVVEQLFGGSGSGVAGDELVFRFEPM
IVAVECRDVAAAAALVAAAIGAGFRESGITSLQKRAMVAIRCSIRMEVPLGQIDELVVSP
EYVRYLVRIANSKMEANKRRMNGFLDLLQTKGLSYPSGLSNNSNSGGQSDDYEASVGPEV
KIPSDTSAKTNDEYLVTKMRNGGRSRDDDDTGSIEAQYFGKQDSAWSQGVNHGSGNAKRL
LTLEKLRENKNHLSTTTLKISGEPIEKLFLWGQASCVFTIGEEQQVLTFGGFGGPGRHAR
RNYSLLLDHKSGLLTEMIFKASPSPRMGHTVTAVDNTTYIIGGRGGPSEILDDVWILPSV
GNTWSKLECCGDLFRPRHRHAAAAVASKIYVFGGLSNEGIYSCMNVLDTKNMQWSVLAAS
GEWPCARHSHSMVSYGTNLFMFGGHDGQRALKDFYSFDTTKLRWNKENTNGGTPSPRFSH
CMFIYKNYLGILGGCPITENNQEVTLLNINHRVWFCVSVPLLSQSLCVRSSSVVIKDDLV
ILGGGASCYAFGTKFSQPIVLDLHSVESMFKYDRNKDGTVQRRDAISVVELSRDEQNGIL
DHDTKLQDACSGSLTDSSPLVLQLGKTYAKLAKDIMKKFGWLDLSRKVRISHDNGHVLFP
INESFCALNAEEHINRNLDDSCTFGESLVFSEKKLVGDNLSLQDALIFFSSCNGSVMKDE
LAISRKPSKSPQTIMKELVSSLLESKGMPSQLLQQLPARWETLGDIVILPKTCFKNPLWE
SVSEELWPLVAKSLGAQRLARQGKIMPNGTRDSTLELLLGDNGWVTHYENGICYSLDATK
CMFSSGNRSEKLRMGQLNCRDEVVVDLFAGIGYFVLPFLVKANAKLVYACEWNPHALEAL
RRNVSDNRVEDRCIILEGDNRVTAPKSVADRVCLGLLPSSECSWATAVEALRVGGGVLHI
HGNVNDSDETRWLDSVVESISNVAKNHGLSWNVSVEHVERVKWYGPRIRHLVVDVTCRQI
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggtcgccggaaggcggcggcgctggctgcgctctcctcgccgacgccggac
aggtccccgaagggcggtgtcgacgccccgatcgctccgctcctcgatgccctcaactcc
cacccggacctcttcactacctcctcctgctccggccgcgtctccgtcctcgcgcagcct
ccgccgccgcatgagggctggggcgagggcgcccccaagccgaagaagaaggcgcggggc
ggcgggtgggtatacgtatcgcacgaccctgccgatccggacgctgtggtggagcagctg
ttcggcgggagcgggtcgggagtggcgggggacgagctggtgttcaggttcgagccgatg
atcgtggcggtggagtgcagagacgttgccgcagctgcggcgctcgtcgcagccgcgatc
ggtgcggggttccgggaatcaggtatcacaagcttgcagaaacgtgcaatggtagcaata
agatgctcaattcgcatggaagtgccactggggcagattgacgaacttgttgtttctccg
gagtatgtccgctaccttgttagaattgccaacagtaaaatggaggcaaataaaaggcga
atgaatggatttttggatctcttgcaaactaagggtttgtcatacccatcagggttatca
aacaactctaatagtggtggtcagtctgatgattacgaggcttctgtgggtcctgaagtt
aagataccatcagatacaagtgccaaaacaaatgatgagtacttagttacaaaaatgaga
aatggtggacgtagtcgtgatgatgatgatacaggttcaatagaagcacagtattttgga
aaacaagactctgcatggagccagggtgtcaatcatggttctggtaatgctaaacgatta
ttaacgctggagaagctgcgagaaaataaaaatcatctctctaccacaacattgaagatt
agcggtgaaccaattgagaagctcttcttatggggccaagcctcttgtgtgtttactatt
ggagaagagcagcaggtcctaacttttggtggttttgggggaccagggcgacatgcaagg
agaaactattcccttctactcgatcacaaatctggtctgttgacagaaatgatctttaaa
gcatctccttcaccacggatggggcatacagttactgcagttgataataccacttatata
attggaggtagaggtggcccttcagaaattcttgatgatgtctggattttgccaagtgtt
gggaatacatggtcaaaactggagtgttgtggagatctgttccgaccaaggcaccgacat
gcagctgctgcagtagcttcaaaaatttatgtatttggcggactcagtaatgaaggcata
tattcttgtatgaatgtattagacacaaaaaatatgcaatggagtgtacttgctgcttca
ggcgaatggccatgtgctcgacattcacattctatggtctcatatggtacaaatctattc
atgttcggaggtcatgatggccaacgggcactgaaggacttctacagttttgatacaaca
aaacttaggtggaacaaggaaaacacaaatgggggaactccgtcacctagattttcacac
tgcatgttcatctacaaaaattatcttgggatacttggtggctgccctattacagaaaac
aatcaagaagttacattgctgaacataaatcatcgagtctggttttgtgtttcggttcca
ttgctgagccagtccctctgtgtccgtagttcatcggttgtcattaaagatgatcttgtt
attttaggtggtggtgcatcttgttatgcattcggaaccaaattcagtcaaccaatagtt
cttgatctgcattcagtggagtctatgtttaaatatgataggaacaaagatggcacagtt
caaaggcgtgatgcaatatctgttgttgaattgtcaagagatgaacaaaatggcatcctt
gatcatgacacaaaattacaagatgcttgttcgggtagtttgacggactctagccctctg
gttcttcaactggggaagacatatgccaaattagcaaaggacattatgaaaaagtttgga
tggttggatctttctagaaaagttcgaataagtcatgataatggccatgttctttttcct
attaacgaatctttctgtgccctaaatgctgaagagcatatcaataggaatcttgatgat
tcatgtacctttggggaatcattagtattttctgaaaagaagcttgtaggggacaaccta
tctcttcaggatgcattaatttttttttcatcttgcaatggttccgttatgaaagatgaa
ctagccatcagccgaaagccttccaagtctcctcaaactatcatgaaagaacttgtatct
tctctactggaaagtaaagggatgccctctcagttgttgcagcagcttccggctaggtgg
gagacacttggtgatatcgtcatacttccaaagacatgttttaagaatccattgtgggaa
tctgttagcgaggaactttggccactagttgccaagtcacttggtgcacaacgtcttgca
cgccaaggtaaaatcatgccaaatggcacaagagatagtacactggaacttcttctgggt
gataacggatgggttacccattatgaaaatggcatctgctattcacttgatgcaacaaaa
tgcatgttttcttctggtaatcgttcagagaaacttcgcatgggacagctaaactgcaga
gatgaggtggtcgtggatttgtttgctggaattggatattttgttcttccatttcttgtg
aaggctaatgccaagctagtttatgcatgtgagtggaatccacatgctctggaggctctt
cggcgcaatgttagtgacaacagagtggaggatcgatgtattatacttgaaggagataac
cgggtgactgcacccaaaagtgttgctgatcgagtctgtcttggattgttaccctcaagt
gaatgtagctgggccactgctgtcgaagctttaagggttggcgggggcgtgttgcatatt
catgggaatgttaacgactctgatgagacacgctggttggacagtgttgttgaatccatc
agtaatgtcgccaaaaatcatggactatcttggaacgtgtcagtggagcatgttgaacgt
gtcaaatggtacgggccgcgtattcgccaccttgtagttgatgttacatgcaggcaaatc
tag

DBGET integrated database retrieval system