KEGG   Zea mays (maize): 103633296Help
Entry
103633296         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC103633296 isoform X2
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
zma  Zea mays (maize)
Pathway
zma00020  Citrate cycle (TCA cycle)
zma00480  Glutathione metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
zma01210  2-Oxocarboxylic acid metabolism
zma01230  Biosynthesis of amino acids
zma04146  Peroxisome
Module
zma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103633296
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103633296
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103633296
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     103633296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 103633296
NCBI-ProteinID: XP_008653230
Position
7
AA seq 220 aa AA seqDB search
MIILSDSSAPPPPPILPAADNRNAPRFAAEEQGLATCSLSSMAAPSVTAMYALFATANLI
LFFFPAFRRNYDSAWTLKNVSAHAARKTGGRADHWFRQTGSSCRHRIHGDEMTRVFWQSI
KDKLIFPFLDLDIKYYDLGILHGEATDDKVTVEAAEATLKYNVAIKCATITPGETRRTYE
ARLVAIYRHVREDGVEGQPISVSTEQFANFEWQPVIWIFA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcatccttagcgactcctcggcgccgccgccgccgccgatcttgccggccgccgac
aaccgcaacgcgccccgcttcgcggccgaggagcaaggcttggccacctgctccttgagc
tcgatggcggcgcccagcgtcaccgcaatgtacgccttgttcgccaccgcaaacctcatc
ctcttttttttccctgcgttccgaagaaactacgactctgcctggactctcaagaacgtc
agtgcgcatgcagctcggaaaacaggtggccgagcggaccactggttccgtcaaacaggg
agctcgtgcaggcaccgaatccatggcgatgagatgaccagggtattctggcagtctatc
aaggacaagcttatcttcccatttctggacctggacatcaagtactatgatttggggata
ctgcacggtgaagcaactgatgacaaggtcacagtggaggctgcagaggctactctcaag
tacaatgtggctattaagtgtgcgaccattactccaggtgaaactagaagaacgtatgaa
gctagacttgttgcaatttatagacatgtaagagaggatggagttgagggacaacctatt
tctgtttcaacagaacaatttgcaaactttgaatggcaaccagttatctggatctttgcc
tga

DBGET integrated database retrieval system