KEGG   Zea mays (maize): 103638000Help
Entry
103638000         CDS       T01088                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
zma  Zea mays (maize)
Pathway
zma03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103638000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zma03041]
    103638000
Enzymes [BR:zma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103638000
Spliceosome [BR:zma03041]
 Complex C
  Other components
   Step II factors
    103638000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 DUF2075 ABC_tran cobW AAA_16 T2SSE Helicase_RecD AAA_33 Flavi_DEAD AAA_29 Dynamin_N AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 103638000
NCBI-ProteinID: XP_008659219
Position
9
AA seq 745 aa AA seqDB search
MDRDPWAKFRRPNSEHPAQSEETRTHQHPGVAGARRPNAMPSPSPAPPPVLPISEHEDEI
VAAVDANPVVVVIGETGSGKSTQLSQILHRRGYTRRGAIAVTQPRRVAAVSVSRRVAQEL
GVPLGDEVGYAIRFEDRTSERTCIKYLTDGILLRESLSNPELKQYSVIILDEAHERSLNT
DILLGLMKRLIKDRASDLKVLITSATLDGLKVSKFFSGCPVLNIPGTLFPVEKFYSTDRP
TNYIESSLRTAIDIHAKEPPGDVLIFMTGKDDIDKMVSKLEERIRNLEEGSCIDALVLPL
HGSLPPELQVRVFAPAPPNCRRFIVATNVAETSLTVDGVVFVIDCGYVKQRQYNPSSGMY
SLDVVQISRVQADQRAGRAGRTRPGKCYRLYPISIYQNEFLEATVPEIQRSSLAGSVLYL
KSLNLPDINILKFDFLDPPSRESLEDALRQLYLIDAIDENGQITDVGRVMAELPLEPSLS
RTLIEANELGCLSQALTVASILSAEITLRSVSKDVVDGKRKRQELPDGSGWGDHIQLLQI
FESWDQTGYDTKWCSHHDLQVRGMKLSKDVRNQLCQIIQKIAKGSTDVDARKSRKNDPDY
RKLRRALCVGYGNQLAERMLHHNGYHTVGYRTQLVQVHPSSVLEGDEYGKFPMYVIYHEL
ISTTRPYMRNVCAVEQAWVQPILKKLDKLDINRLSGGSSAPGDSELLGDNKQVNSSKNDV
GVKQSEVDSKIQAARERYLARKGKK
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgacccatgggcaaaattccgacgcccaaacagtgagcacccagcccaatca
gaggagacacgcacgcaccagcaccctggtgtggccggtgcccggcggccaaacgcgatg
ccatctccgtctccagccccgccgccagtgctgccgatctcggagcacgaggacgagata
gtcgccgcggtggacgcgaacccagtggtggtggtcatcggcgagactggctccggcaag
agcactcagctctcccagatcctccaccgccgcggatacacccgtcggggtgccatcgct
gtcacccagccccgccgcgttgctgcggtttccgtttccagaagagtagctcaagagctt
ggtgttccacttggggatgaagttggttatgcaattcgatttgaggacagaacttcagaa
agaacatgcataaaatacctcacagacggcattcttctccgtgaaagcctttcaaatcct
gagttgaagcagtactcagtaatcatactggatgaagctcacgagcgtagcttaaacact
gatatccttttaggtttgatgaaaagattgatcaaggaccgagcttcagatttaaaagtt
ttaatcacctctgcgactcttgacggtttaaaagtttcaaagttcttctcaggatgccct
gtgttaaacattcctggaactttattccctgtggagaaattttacagcactgatcgccca
acaaattatatagaatcttcactcagaacagctatagatatccatgccaaggaacctcct
ggagatgtcttaatatttatgacaggaaaggatgatattgacaagatggtatcaaaattg
gaggaaagaattcgaaatcttgaggagggctcctgcatcgatgctcttgtccttcctctt
catggttctttgccacctgagctgcaggttagagtatttgctccagcacctccaaactgc
cgacgcttcattgttgcaacaaatgttgctgaaacttcgctgactgtagatggtgtcgtg
ttcgtgattgattgtggttatgtaaagcagcgccaatacaatccatcaagtggaatgtat
tcacttgatgttgtccaaatcagcagagtgcaggctgatcagcgagcagggcgagctggt
agaactcggcccggcaagtgctataggctatacccaatttccatatatcagaatgagttt
cttgaggcaacagtccctgaaattcaacgctcttctcttgctggaagtgttctgtatctg
aaatcgttaaatcttccagacatcaacatactgaagtttgattttctagatccaccatca
cgtgagtcattagaagatgctttgaggcaattatacctcattgatgcaattgatgaaaac
ggacaaataacggatgttggacgagttatggcagagcttcctcttgagccgtctctttca
aggactttgattgaagcaaatgaattgggatgcctatctcaggcgttaactgttgcatcg
attttgtcagcagaaataacattgcgatcagttagcaaggacgtggtggatggaaagagg
aaaaggcaggagctccctgatgggtctggctggggtgaccatatacaattgcttcagata
tttgaaagctgggaccaaactggctatgacacaaaatggtgctctcatcatgatttgcag
gtgcggggtatgaaattgagcaaagatgtgaggaaccaactatgtcagattattcaaaaa
attgcaaaaggttcaactgatgtggatgcaaggaaaagccggaagaatgaccctgattat
agaaagctgaggagagctctctgcgtaggatatggtaaccagctagctgagaggatgctg
catcacaatggctaccatactgttggctataggacccaacttgtacaggtgcatccatct
tctgtactggaaggcgatgagtatggaaagtttccaatgtacgttatttatcatgagctg
ataagtacaactcgtccatacatgagaaatgtctgcgccgtcgagcaagcctgggttcag
cctatattaaagaagctcgacaaattagacataaacagattaagtggtggttcgagtgca
ccgggagattctgaacttctgggagacaataagcaagtgaactcgtcaaagaatgacgtg
ggtgtaaaacaatcagaggtggacagtaaaatccaggcagctcgagagcggtaccttgca
cgaaaaggcaagaaatga

DBGET integrated database retrieval system