KEGG   Zea mays (maize): 103645801Help
Entry
103645801         CDS       T01088                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 6
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103645801
   00500 Starch and sucrose metabolism
    103645801
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103645801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103645801
NCBI-ProteinID: XP_008668742
Position
2
AA seq 606 aa AA seqDB search
MCHSHSLVTGPMAANPLATLAIAVFLICLLLPTSSSSSSICVARTQDHVRTAFHFQPAKN
WQNDPNGPVYYNGMYHLFYQYNPHGALWDVGNLSWGDSVSGDLVNWAALGNALDPTAPFD
ANGCASGSVTILPDGTPAILYSGIDADRRQVQNVAFPKNPRDPLLREWAKPAYNPVVPLP
ADVSANDFRDPTTAWVGRDGLWRFAISAVADGVGATLVYRSADFLRWERRAAPLHASQDA
VMAECPDLFPVAARGAEGLDASARGAGVRHVLKVSMPDTLEDYYAVGTYDDAADTFTPDE
DCGGGDYRRWRRIDRGHLYASKTFLDARRMRRVLWAWVNESDSEADDVARGWSGLQSFPR
ALWLDGGGKQLVQWPVEEIETLRTRRAAPLQEVEPGGGVREVTGIVSSQADVDVVFEIPS
LRRAEGLDPGRLHDPDALCREKGGSLTGGVGPFGLLVMASGDMREHTAVFFRVFRILHEY
AVLMCTDLSRSSTKAGVYKPTHGGFVDVDIEKDMSISLRTLIDHSIVESFGGGGRTCMTA
RVYPEHVAAGSSSHLYVFNNGSAAVKVSKLEAWELASASVNVDDDGGLMAGGSFANMCRA
EEYNSS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcactcacattcgctggtgaccgggccaatggcagcaaatccccttgccacgctc
gccatcgcggtgttcttgatctgccttcttctccccacttcgtcttcttcgtcatcgatt
tgtgtcgcgaggacgcaggaccacgtgagaacggcgttccacttccagcccgccaagaac
tggcagaacgatccgaatgggcccgtgtactacaacggcatgtaccacctgttctaccag
tacaacccgcacggcgcgctctgggacgtgggcaacctctcatggggcgactccgtctcc
ggcgacctcgtgaactgggcggcactcggcaacgcgctcgacccgacggcgccattcgac
gccaacggctgcgcgtcagggtctgtcaccatccttcccgacggcacgccggcgatcctc
tactccggcatcgacgcggaccgccggcaggtccagaacgtcgcgttccccaagaacccg
cgcgacccgctcctccgcgagtgggccaagcccgcctacaaccccgtcgtcccgctcccc
gccgacgtgtcggcgaacgacttccgggaccccaccacggcgtgggtcggccgggacggg
ctgtggcggttcgccatctccgcggtggccgacggcgtgggcgccacgctcgtgtaccgc
agcgcggacttcctgcgatgggagaggcgcgctgcgccgctccatgcgtctcaggacgcc
gtgatggccgagtgcccggacctgttccccgtggcggcgcgcggcgcggaggggctggac
gcgtcggcgcgcggcgctggtgtgcggcacgtcctcaaggtgagcatgccggacacgctg
gaggactactacgcggtcgggacgtacgacgacgcggcggacacgttcacgccggacgag
gactgcggcggcggcgactaccgcaggtggcggaggatcgaccgcggacacctgtacgcg
tccaagacattcttggacgcgcgcaggatgcggcgggtgctgtgggcgtgggtgaacgag
tccgacagcgaggccgacgacgtcgcccggggctggtccggcctgcagtcgttcccgcgg
gcgctgtggctggacggcggcgggaagcagctggtgcagtggcccgtggaggagatcgag
acgctgaggacgaggcgcgcggcgccgctgcaggaggtggagcccggcggcggggtgcgc
gaggtcaccggcatcgtgagctcgcaggcggacgtggacgtggtgttcgagatcccgagc
ctccggcgggccgagggactggaccccggccggctgcatgaccccgacgcgctgtgccgg
gagaagggcggctccctgacaggcggagtcggcccgttcgggctgctggtgatggcctcc
ggagacatgcgcgagcacaccgccgtgttcttcagggttttcaggatcctgcacgagtac
gctgttctcatgtgcacggacctcagcaggtcctccacgaaggcaggcgtgtacaagcca
acgcatggagggttcgtcgacgtggacatcgagaaagacatgagcatatcgttaagaaca
ttgatcgatcactcgatcgtggagagcttcggcggcggcgggaggacgtgcatgacggct
agagtgtaccccgagcacgttgcagcaggcagcagcagccacctatacgtgttcaacaat
gggtcagctgcagtgaaggtgtccaagctcgaggcatgggagcttgccagtgcgagtgtc
aatgttgacgacgatggcggtctgatggctggtggatcgttcgcgaacatgtgccgcgct
gaggagtacaattctagctag

DBGET integrated database retrieval system