KEGG   Zea mays (maize): 103652376Help
Entry
103652376         CDS       T01088                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    103652376
Membrane trafficking [BR:zma04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103652376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2
Motif
Other DBs
NCBI-GeneID: 103652376
NCBI-ProteinID: XP_020406553
Position
3
AA seq 349 aa AA seqDB search
MPCKESFAWAMIPLFEGNHAGGLSDAAYPSSPLATSLPGSTSQDSIVDPILKLTLDGKVN
HYSSGSSVIVEISNLNKVKESYIVDSLQDPKRKVHKPVKGVLRLEVEKLHGGHNDVDNTS
EGGSMANDLNDAGDINNGRSNRSCFDGIHSFMNSIAIAQKDAHHNGIISNAENGDNFEAF
DFRMLTRSEPFSQLFHCLYVYPLTVSLSRKRNLFVRVELRKDDSDIRKPPLEVVHPRERN
MKLQKWGHTQIAVGTRMASYQDKVKISLPALLTPQHHLVFTFFHVDLQMKLEAPKPVIVG
HSVLPLSTHIQYASSTQLFFSVVATLYYSLSLVSCFKYETTSHSQPLLF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtaaagagtcatttgcatgggccatgattcctctgtttgaaggtaaccatgcg
ggtggtcttagtgatgctgcttatcctagcagtcctttagcaacaagtttaccaggatca
acttctcaagatagtattgtggaccctattttaaagcttactttagatggaaaagtgaac
cattactcgagtggaagctcagttattgtagagatatcaaacctaaacaaagtgaaggaa
agctatatagtggactccctccaagatccaaaacggaaagtacataaaccagtgaaaggt
gtattgagattagaagtggaaaaacttcatggtggccacaatgatgtggataacacttct
gaaggcggaagcatggccaatgatttgaatgatgctggtgacatcaataatggcagaagc
aacagaagttgctttgatgggattcacagttttatgaattctattgccattgcccagaaa
gatgctcatcataatggaatcatttctaatgctgagaatggtgacaattttgaagctttt
gactttcggatgctgacccgaagtgagccgttttcacaactttttcattgcctctatgtg
tacccgttgactgttagcttgagccgcaaaagaaacctgtttgttagagtggaactgaga
aaggacgattctgacatccgaaagcctccattagaggttgttcatcctagggagcggaat
atgaagctacagaagtggggccatacacagattgctgttggaacaagaatggcttcctac
caagataaagttaaaatcagcctacctgctcttttgacaccccaacatcatcttgtgttc
acatttttccatgtagatcttcaaatgaaacttgaagcaccgaaaccagtgatcgttggg
cattctgtacttccactgtcgacacatattcagtatgcatcatctactcaattatttttt
agtgtagtagcaacattatattactctttgtcacttgtcagctgcttcaaatatgagacc
acatcccactctcagccattactgttttag

DBGET integrated database retrieval system