KEGG   Zea mays (maize): 103654058Help
Entry
103654058         CDS       T01088                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
zma  Zea mays (maize)
Pathway
zma00450  Selenocompound metabolism
zma00970  Aminoacyl-tRNA biosynthesis
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103654058
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103654058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zma01007]
    103654058
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zma03016]
    103654058
Enzymes [BR:zma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103654058
Amino acid related enzymes [BR:zma01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103654058
Transfer RNA biogenesis [BR:zma03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103654058
 Prokaryotic type
   Other AARSs
    103654058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Hormone_recep tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 103654058
NCBI-ProteinID: XP_008679089
UniProt: K7UJ45 A0A3L6F812
Position
4
AA seq 802 aa AA seqDB search
MASPSSSPPPKLPIPGRRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAL
YICGTDEYGTATETKAMEEECSPKEICDKYHAIHSEVYKWFDIEFDKFGRTSSPQQTTIC
QAIFHKLMENNWLSENTMQQLYCDTCQRFLADRLVEGACPTEGCTNKAARGDQCDNCSHM
LNPTELIDPKCKVCKNTPHIRETDHLFLDLPRIEDKLVNYINDTSVAGMWSQNAIQATNA
WLKEGLKSRCITRDLKWGVPVPIEKYKDKVFYVWFDAPIGYVSITSSYTPEWERWWKNPD
NVELFQFMGKDNVPFHTIMFPSTLLGTGENWTMMKTICVTEYLNYEGGKFSKSKGIGVFG
NDAKDTNIPPEVWRYYLLMNRPEASDTLFTWTDLQAKLNSELLNNLGNFINRVLSFIAKP
AGAGYDSIIPDAPGAESHPSTSVIAEKVSKSVEQYLDAMEKVKLKQGLKSAMGISTDGNR
YLQDSEFWKLYKDNPASCAIVMKTSVGLVYLLACLLEPFMPSFSKEVLRQLNLSPEENIS
FSEENGESVKAKPPWDLVPAGHKIGRPVPLFEELKDEKVSEYREKYAGSQAERNSKAVAD
AEATKIANQTQSIALSGGSKKEQKKQSGNSKSKVAEAELSVAKLEIRVGLIRKAEKHPDA
DSLYVEEIDVGEEAPRTVVSGLVKYIPLEEIQNRKVCVLCNLKPVVMRGIKSDAMVLAAS
NEDHTRVELVEPPADAAVGERVTFAGHSGETEASLSGKSKVWEKLAADLRSNGDLVACYQ
DVPFMTSAGVCKVQTIANGEIR
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccgtcgtcgtctccgccgccgaagctgccgatccccggccgccgcaacata
ctcatcaccagcgccttaccctatgtgaataacgtcccgcacctcgggaacatcatcgga
tgcgttctgagcgccgacgtgttcgcgcgctactgcaggctacgcgggtacaacgcgctc
tacatatgcgggacggacgagtacgggacggccacggagaccaaggccatggaggaggag
tgctcgcccaaggagatctgtgacaagtaccatgctatccacagtgaggtttacaagtgg
tttgacatagaatttgacaaatttgggcgtacatcctctcctcaacagacaacaatctgc
caagcaattttccataaattgatggaaaacaattggctatcagaaaacaccatgcagcag
ctttactgtgatacatgtcaaaggtttttggcagatagacttgtagaaggagcatgccca
acagaagggtgtactaataaagctgcgcgaggtgatcaatgtgacaattgcagccacatg
ttgaatccaactgaactaattgatccaaagtgtaaggtctgtaagaatactcctcatatt
cgtgaaacggatcacttgttcttggatctccctcgaatagaagacaagttggtaaactac
attaatgatacttcagtagctggtatgtggagtcaaaatgccattcaagctacaaatgca
tggttaaaggaaggactaaaatcacgctgtatcacaagagatcttaaatggggagttcct
gttccaattgagaagtataaagataaggttttctatgtctggttcgatgcaccgattggc
tacgtgtccatcacatcatcttatacacctgagtgggagaggtggtggaagaatcctgat
aatgtggaattatttcagttcatgggcaaagataatgtgccatttcatacgatcatgttt
ccttcaacactactaggaactggtgaaaattggacaatgatgaagaccatttgtgtcacc
gaatatctaaattacgaaggaggaaaattctccaagagtaagggtatcggagttttcggt
aatgatgccaaggataccaatattcctcctgaagtatggcgatactacctgcttatgaat
cgacctgaggcatcagatacactctttacctggactgatttgcaagccaaattgaacagc
gaattgttaaacaacttgggaaatttcatcaatcgtgtgctaagctttattgcaaaacca
gctggggctggatatgattcaattatacccgatgctcctggtgctgagtcacatccatcg
acaagtgtcattgcagaaaaagttagtaaatcggttgaacaatatcttgatgcaatggaa
aaggtaaagctgaaacaaggactgaagagtgcaatgggcatctctactgatggaaatcgt
tatttgcaggacagcgaattttggaaactttataaggacaatccagcaagctgtgcgatt
gtgatgaaaacttcagttggtcttgtatatctccttgcctgtctcctggaacctttcatg
ccttccttttcaaaagaagtgctacgtcaattaaacctgtccccagaagaaaatatttct
ttcagtgaagaaaatggcgaaagtgtgaaggcaaaacccccttgggatcttgtaccagca
gggcacaaaatagggaggcctgtacctctgtttgaggaattgaaagatgaaaaggtgagt
gagtatagggaaaaatatgcgggcagtcaagctgagaggaactcgaaagcagtggctgac
gctgaagccacaaaaattgctaaccaaacccaaagcatagcattatctggaggctcaaaa
aaggaacaaaagaaacagtctggtaactcaaaatcaaaggtggctgaggcagaattatcc
gttgcaaagttggagattcgagtggggcttatcagaaaagcggagaagcatccagacgcc
gattcgctgtatgtagaggaaatcgatgttggagaggaggctccaagaacggtggttagt
ggccttgtcaaatacattcctcttgaagaaatacagaaccggaaagtctgtgttctctgc
aatctgaaaccggtggtgatgcgtggtataaaatcggatgccatggttttggctgcttct
aatgaggaccatactagggttgagctggtcgagccaccagcggatgctgccgtgggggag
agggtgacctttgccgggcactccggtgagaccgaggcttctctcagtggcaagagcaag
gtgtgggagaagctagcggctgacctgcgtagcaatggcgaccttgtggcctgctaccaa
gatgtccccttcatgacttcggctggagtctgcaaggtacagacaatagcgaatggggaa
atccgctag

DBGET integrated database retrieval system