KEGG   Zea mays (maize): 103655219Help
Entry
103655219         CDS       T01088                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
zma  Zea mays (maize)
Pathway
zma00350  Tyrosine metabolism
zma00360  Phenylalanine metabolism
zma00380  Tryptophan metabolism
zma00950  Isoquinoline alkaloid biosynthesis
zma00965  Betalain biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103655219
   00360 Phenylalanine metabolism
    103655219
   00380 Tryptophan metabolism
    103655219
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103655219
   00950 Isoquinoline alkaloid biosynthesis
    103655219
   00965 Betalain biosynthesis
    103655219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zma04147]
    103655219
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103655219
    4.1.1.105  L-tryptophan decarboxylase
     103655219
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103655219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 103655219
NCBI-ProteinID: XP_008680226
Position
4
AA seq 520 aa AA seqDB search
MGSLDTNPAAMSALGDNACSGFQPLNPDDVRSYLHKAVDFISDYYKSVESLPVLPDVKPG
YLRNELQSAPPTSSAPFDVTMKELTASVVPGMTHWASPNFFAFFPSTNSAATIAGDLIAS
AMNTVGFTWQAAPAATEMEVLALDWLAQLLRLPPSFMNRTGGAARGSGGGVILATTSEAM
LVTLVAARDAALRRSGSHGVSQLPRLAVYAADQTHSTFFKACRLAGFDPANIRCIPTGPE
TDYGLDPARLLEVMQADVDAGLVPTYVCATVGTTSSNAVDPVRAIADAAAVFNAWVHIDA
AYAGSACICPEFRHHLDGVERVDSISMSPHKWLMTCLDCTCLWVRDTHRLTGSLETNPEY
LKNDASESGNVTDLKDMQVGVGRRFRGLKLWMVMRTYGASKLQEHIRSDVAMAKMFEDAV
RADDRFEVVVPRNFALVCFRIKPRGGMTEEDADEVNRELMERLNRTGKAYLAHTVVGGRF
VLRFAVGSSLQEERHVRSAWELINKTTNEIMLEPEQIVVE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttggacaccaaccctgccgccatgtccgccttgggcgacaacgcctgctcc
ggcttccagccgctgaacccggacgacgtccgctcctacctccacaaggccgtcgacttc
atctccgactactacaagtccgtcgagtcactgcccgtgctgcccgacgtcaagccgggg
tacctacggaacgagctgcagtccgcgccacccacgtcctccgccccgttcgacgtcacc
atgaaggagctcaccgcctccgtcgtccccggcatgacccactgggccagccccaacttc
ttcgccttcttcccgtccaccaacagcgctgcgaccatcgccggcgacctcatcgcctct
gccatgaacaccgtcggcttcacgtggcaagccgcgcccgccgccaccgagatggaggtc
ctcgcgctcgactggctcgcgcagcttctgcgcctgccgcccagcttcatgaaccgcacc
ggcggggctgcgcgtggctccggcggcggcgtcatcctcgccaccaccagcgaagccatg
ctcgtcacgctcgtcgcggcgcgtgacgccgcgctgcgtcggagcggctcacacggcgtg
tcccagctgccgcgcttggccgtgtacgccgcggaccagacgcactccaccttcttcaag
gcgtgccgcctcgccggcttcgaccccgccaacatccgctgcatccccaccggcccggag
acggactacggcctcgacccggcgaggctgctcgaggtcatgcaggccgacgtcgacgcc
ggcctcgtgccgacctacgtctgcgccacggtcggcaccacgtcgtccaacgccgtcgac
cctgtgcgagccattgccgatgccgccgccgtgttcaacgcgtgggtccacatcgacgcc
gcgtacgctggcagcgcgtgcatctgccctgagttccggcaccacctcgacggcgtggag
cgcgtggactccatcagcatgagcccgcacaagtggctcatgacgtgcctggactgcacg
tgcctgtgggtgcgcgacacgcaccggctcaccggctcgctggagaccaacccggagtac
ctcaagaacgacgccagcgagtccggcaacgtcaccgacctcaaggacatgcaggtcggc
gtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgcctcc
aagctgcaggagcacatccggagtgacgtcgccatggccaagatgttcgaggacgccgta
cgcgctgacgaccggttcgaggtcgtggttccgaggaacttcgctctcgtgtgcttcagg
atcaagccccgtggtggcatgacggaggaggacgccgacgaggtcaaccgtgagctcatg
gagcgcctcaacaggaccgggaaggcgtacctggcgcacacggtggtaggcggcaggttc
gtgctgcggttcgccgtcggttcgtcgctgcaggaggagaggcacgtccggagcgcgtgg
gagctcatcaacaagacaaccaatgagatcatgctggaaccggaacagatcgttgtggag
tag

DBGET integrated database retrieval system