KEGG   Zea mays (maize): 103655286Help
Entry
103655286         CDS       T01088                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ent-kaur-16-ene synthase, chloroplastic
  KO
K04121  ent-kaurene synthase [EC:4.2.3.19]
Organism
zma  Zea mays (maize)
Pathway
zma00904  Diterpenoid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    103655286
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.19  ent-kaurene synthase
     103655286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth SQHop_cyclase_C
Motif
Other DBs
NCBI-GeneID: 103655286
NCBI-ProteinID: XP_023158035
Position
4
AA seq 828 aa AA seqDB search
MASFSYGGAPPPSHSGLRHYPTVHRPGLLPATAACTRGGAELLRRQSRATTPRTKLAEKM
VREKLLMGLPPPSSYDTAWLAMVPAPGSARASRFPQCVEWIMQNQRSDGSWGLQGRQGDD
PSLLIKDALSSTLACVLALKTWGVGDEHVGKGLRFIGHNLSSVTTYGDVGSRPVGFNVIF
PGMLARCIGMGVEMPLAPADVDGIFRLRDKELPRWLDVDFGTSTIIKAFRAYLAEGLGNW
DEAMAYQRKNGSLFNSPATTAAAAIHSYDRGAVQYLDSLVNLFGSSVPAMYPRILYARLR
MVDALEKTGISRSFSSEINGILDMTYASWLGXNDEEIMLDMTTCAMAFRLLRMHGYDVSS
DASLGQFSEESSFHDSIQGCLGDTEALLELHKASQVQIREQETAILRSIGSWSAKLLEQQ
LRSNKVSRNIDPAEVDYALKHPFYTTLDRLEHRRNIEHFKTTAIQVLKSAYRACVPAGEE
IAALAAADFHASQTVYQEELQCLESWVKELRLQELEFARIMPLICFFPPAATLFPCEQHE
ARMAMSKHNILLTVVDDLFDVGGSREEMENLVKLVEMWDAHNRVGFCSERVEIVFRAIYD
TSNHLAAKAAAVQKRNIIHHLAELWANTVRAMMAEANWAMTGHLPTFEEYMAAGEPSFGL
GPIVLASLYLVGPELPEDVVTSQEYNEMFRHMNVCGRLLNDLQSYEREKEQGKVNSVLLL
LALEEEGGSIEAVKREVRRAIEASRIQLLRLVLRNESEVPWPCRQVFWNICKVVHQFYVH
VDGYASAKQMMHSCTPGTRWCITRCRSHARRPTYNKFSQLSLGVGVHC
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgttcagctacggcggtgctcctcctccatcacactccggtctccgccattac
cccaccgtgcatcgaccaggactcctgccggccactgccgcgtgtacgcgtggcggcgca
gagctgttgcggcggcagtcacgagctaccaccccgcgcacaaagctggcggagaaaatg
gtcagggagaagctcctgatgggtttgccgccgccgtcgtcgtacgacacggcctggctt
gcgatggtgccggcgcccgggagcgctcgggcgtcgcgcttccctcagtgcgtggagtgg
atcatgcagaaccagcggagcgacgggtcctgggggctgcagggccgccagggcgatgac
ccctcgcttcttatcaaggacgcgctgtcgtctacgttggcgtgcgtcctggcgctcaag
acgtggggcgtcggcgacgagcacgtcgggaaagggctccgcttcatcgggcacaacttg
tcatccgtgacgacgtacggcgacgttggatcaaggccggtggggttcaacgtcatcttc
cccgggatgcttgcacgttgcatcggcatgggcgtggagatgcctcttgccccggccgac
gttgacggcatcttccggctgcgtgacaaagagctaccaaggtggttggacgttgatttc
ggtacaagtacaataatcaaagctttcagggcctacctagcagaagggttgggcaactgg
gacgaagccatggcgtaccagaggaagaacgggtccctgttcaactcaccggcaacgacg
gccgcagctgccatccacagctacgaccggggagcagtgcagtacttggattcacttgtc
aacttgttcggcagctcagtgccagcaatgtatccacggatcttatacgcccggcttcgt
atggtggatgctttagaaaaaactggcatctctcggagcttttccagtgagatcaacggc
atacttgacatgacatacgcgtcctggcttggcnncaacgacgaggagataatgctggac
atgacgacgtgcgcaatggcattccgtctccttcgtatgcacggatatgacgtctcctcc
gatgcgtccttgggccagttcagcgaagaatccagtttccatgattccatacaagggtgt
ctaggcgatacggaggcgttgctggaacttcacaaagcatcgcaggttcagatcagggaa
caagagacggcaatcctacgtagcattgggtcgtggtcagctaaactcctggagcagcaa
ctgcgttccaacaaggtatcgaggaacatagaccccgctgaggtggattatgcgctcaaa
catcccttctacaccaccttagaccggctggagcaccggcggaacatagaacatttcaag
acaacggccatccaggtgctcaaatcagcataccgagcttgtgtcccagcaggtgaggaa
attgcagccctggcagctgctgacttccatgcctcccagactgtgtaccaagaagagcta
cagtgcctggagagctgggtgaaagagctgaggctgcaggagctggagttcgctagaata
atgccgctgatctgcttcttccctcctgctgccaccctgttcccctgcgaacaacatgag
gctcgcatggcaatgagcaagcacaacatcctgttgaccgtggtggatgacctgttcgat
gtcggggggtccagggaagagatggagaacctcgtcaagctggttgaaatgtgggacgcc
cataaccgagttggcttctgctctgagcgcgtggagattgttttccgagctatctacgac
acgagcaaccatctggcagccaaggctgctgcagtacagaagcgcaacatcatccatcat
ctcgccgagctgtgggcgaacacggtgagggccatgatggctgaggcgaactgggcgatg
acagggcacctgcccaccttcgaggagtacatggcggccggcgagccgtcgtttggtctt
ggacccatcgtcctcgcgtcgctctacctcgtcgggccggagcttccggaggacgtggtc
acctcccaggagtacaacgagatgttccggcacatgaacgtctgcggccgtctcctgaac
gacctccagtcatacgaaagggagaaggaacaaggcaaggtcaacagtgtgctgctgctg
ctagcactggaggaggagggcggctccatcgaggctgtcaagagggaggtgaggagagcc
atcgaggcctccaggattcagctgctgcggttggtgctcaggaatgaaagcgaggtgcct
tggccttgcaggcaggttttctggaatatatgcaaggtggtgcaccagttctacgtccac
gtggatggatatgcgtctgccaaacagatgatgcactcatgcacgccgggaacgcggtgg
tgcatcacccgctgcagatcccacgctcgccggcccacatataataagttcagccagctg
tccttgggcgttggtgttcattgttga

DBGET integrated database retrieval system