KEGG   Zea mays (maize): 109943123Help
Entry
109943123         CDS       T01088                                 

Definition
(RefSeq) beta-fructofuranosidase 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109943123
   00500 Starch and sucrose metabolism
    109943123
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109943123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 109943123
NCBI-ProteinID: XP_020401547
Position
10
AA seq 672 aa AA seqDB search
MIPAVADPTTTLDGGARTPLLPETDPRGRAAPAGARQNRPAAAAAATATMTVLTAAVSAV
LLLVLVAVTVLASQEGVDGQGGGGVVAVEVAASRGVAEGVSEKSTAPLLGAGAGAALRDF
SWTNSMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPDSAVWGNITWGHAVSR
DLLHWLHLPLAMVPDHAYDSNGVWSGSATRLPDGRIVMLYTGSTAESAQVQNLAEPADPS
DPLLLEWVKSDANPVLVPPPGIGLTDFRDPTTAWRAAPNDGAAASWRVAIGSKDRDHAGL
ALVYRTEDFVRYDPAPALMHAVPGTGMWECVDFYPVAAAAAGGADGLETSAAPGPGVKHV
VKASLDDDKHDYYAIGTYDPATDAWTPDDVEKDVGVGLRYDYGKFYASKTFYDPVLRRRV
LWGWVGETDSERADVLKGWASVQSIPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSYDGV
ALDRGSVVPLDVGKATQLDIEAVFEVDAEGVGVAEEADVTFNCSTSAGAASRGLLGPFGL
LVLADEDLSERTAVYFYLVKATDGSLKTFFCQDELRSSKANDLVKRVYGSLVPVLDGENL
SVRILVDHSIVESFAQGGRTCITSRVYPTRAINDSARVFLFNNATGVHVKAKSVKIWQLN
SAYIRPYPASSL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggccgttgccgatccgacgacgacgttggacgggggcgcgcgcacgccgttg
ctcccggagaccgaccctcgggggcgcgctgcccccgccggcgctcggcagaatcggccg
gcggcggcggcggcggcgacggcgacgatgaccgttctcaccgccgccgtctccgctgtg
ctcctgctcgtcctcgtggcggtcacggtcctggcgtcgcaggagggagtcgacgggcag
ggtggcgggggcgtcgtcgccgtggaggtggccgcctcccgtggcgtggctgagggcgtg
tcggagaagtccacggccccgctcctcggcgccggcgccggcgccgcgctccgggacttc
tcctggaccaactcgatgctggcgtggcagcgcacggcgttccatttccagccccccaag
aactggatgaacgatccgaacggtcccctgtatcacaagggctggtaccacctgttctac
cagtggaacccggactccgcggtgtggggcaacatcacctggggccacgccgtctcgcgc
gacctcctccactggctccacctaccgctggccatggtgccagaccacgcgtacgacagc
aacggcgtgtggtccgggtccgccacgcgcctcccggacgggcggatcgtgatgctctac
acggggtccacggcggagtcggcgcaggtgcagaacctcgcggagccggccgacccgtcc
gacccgctgctgctggagtgggtcaagtcggacgccaacccggtgctggtgccgccgccg
ggcatcgggctgacggacttccgcgacccgacgacggcgtggcgggcggcgcccaacgac
ggcgcggcggcgtcgtggcgggtcgccatcgggtccaaggaccgggaccacgcggggctg
gcgctggtgtaccgcacggaggacttcgtgcgctacgacccggcgccggcgctgatgcac
gccgtgccgggcaccggcatgtgggagtgcgtggacttctaccccgtggccgcggccgcg
gcgggcggcgccgacgggctggagacgtccgcggcgccgggccccggcgtgaagcacgtg
gtcaaggccagcctcgacgacgacaagcacgactactacgccatcggcacctacgacccg
gccacggacgcctggacccccgacgacgtggagaaggacgtcggcgtcggcctgcgctac
gactacggcaagttctacgcgtccaagaccttctacgaccccgtgctccgccgccgggtg
ctctggggctgggtcggcgagaccgacagcgagcgcgccgacgtcctcaagggctgggca
tccgtgcagtcgatccccaggacggtgctcctggacacgaagacgggcagcaacctgctg
cagtggccggtggtggaggtggagaacctccggatgagcggcaagagctacgacggcgtc
gcgctggaccgcggatccgtcgtgcccctcgacgtcggcaaggcgacacagctggacatc
gaggctgtgttcgaggtggacgcggagggcgtgggcgtggcggaggaggccgacgtgacg
ttcaactgcagcaccagcgcaggcgcggcgagccggggcctgctcggcccgttcggcctg
ctcgtgctggcggacgaggacttgtccgagcgcaccgccgtgtacttctacctcgtcaag
gccacggacggcagcctcaaaactttcttctgccaagacgagctcaggtcatccaaggca
aacgatctggttaagcgagtatacggaagcttggtccctgtgctagatggggagaatctc
tcggtcagaatactggttgaccactccatcgtggagagctttgcccagggcggacggacg
tgcatcacgtcgcgcgtgtacccgacgcgggccatcaacgactccgcccgcgtgttcctc
ttcaacaatgccacgggtgtccacgtcaaggcgaaatccgtcaagatctggcagctcaac
tccgcctacatccgcccatacccagcaagttctctatga

DBGET integrated database retrieval system