KEGG   Zea mays (maize): 541679Help
Entry
541679            CDS       T01088                                 

Gene name
gpm837
Definition
(RefSeq) uncharacterized LOC541679 precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    541679 (gpm837)
   00500 Starch and sucrose metabolism
    541679 (gpm837)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     541679 (gpm837)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 541679
NCBI-ProteinID: NP_001104899
UniProt: Q9ZTQ4
Position
2
AA seq 597 aa AA seqDB search
MARLPLAACAVAAAFYLCLHLASSSSSAPRLAPAPSDGGRRAGRTAYHFQPAKNWQNDPN
GPMYYNGMYHLFYQYNPHGALWGVGNLSWGHSVSGDLVNWAALDTALDPTSPFDANGCWS
ASATILPGGTPAILYTGIDANGEQVQNVAFPRDPADPLLRRWDKPGYNPVIPLPADVPGD
KFRDPSTAWLGRDGLWRVAVSAEVRGVASTLVYRSADFLRWERAPAAAPLHASRAAGMVE
CPDLFPVKEEGDDGDGQGLDASASGAGVRHVLKLSVMDTLQDHYMVGRYDDAADAFVPAE
PERGDDVRGWRRLDYGHVYASKTFFDARGSRRVLWAWANESDSQADDVAKGWSGTFPRKL
WLDEDGKQLRQWPVEEIETLRRKRVVLHRGTALATGGMNEIVGVAGSQADVEVAFKVSSL
AGAEALDPNWLLDPQKLCGEKGASVPGGVGPFGLIVMASSDLREHTAVFFRAIYRYHGRY
KLLMCTDLTRSSTRAGVYKPPYGGFVDVDVEEHETINLRTLIDHSVVESFGADGRMCITA
RVYPEHAETSNSHMFVFNNGTGTVEVSKLEAWELAAATVNSVGGNDSLVMSESNGQS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggctcccgctggccgcctgcgccgtcgccgccgccttctacctgtgcctccac
cttgcgtcgtcgtcctcttccgctcctcgtcttgcgcctgccccgagcgacggcggccgc
cgtgcaggcaggaccgcctaccacttccagccggccaagaactggcagaatgatccgaat
gggccgatgtactacaacggcatgtaccatctcttctaccagtacaacccgcacggcgcg
ctctggggcgtcggcaacctctcctggggccactccgtctccggcgacctcgtgaactgg
gccgctctggacacggcgctggacccgacgtcgcccttcgacgccaacggctgctggtcg
gcgtccgccaccatcctccccggcggcaccccggccatcctctacacgggcatcgacgcc
aacggggagcaggtgcagaacgtggcgttccccagggacccggcggacccgctccttcgc
cggtgggacaagcccggctacaaccccgtcatcccgctccccgccgacgtcccgggcgac
aagttccgggacccctcgacggcgtggctcggtcgcgacgggctgtggcgcgtcgcggtg
tccgccgaggtccgcggcgtggcgtccacgctcgtgtaccggagcgcggacttcctccgc
tgggagcgcgcccccgccgccgcgccgctgcacgcctcgcgcgccgcgggtatggtggag
tgcccggacctgttcccggtgaaggaggagggtgacgacggcgacggccaagggctcgac
gcgtcggcgagcggcgccggggtgcggcacgtgctgaagctcagcgtgatggacacgctc
caggaccactacatggtggggcggtacgacgacgcggcggacgcgttcgtgccggcggag
cccgagcgcggggacgacgtgcgcggctggcggcggctggactacggccacgtgtacgcg
tccaagaccttcttcgacgcgcgcgggagccggcgcgtgctgtgggcgtgggccaacgag
tccgacagccaggccgacgacgtcgccaagggctggtccggcacgttcccgcggaagctg
tggctggacgaggacgggaagcagctgcggcagtggccggtggaggagatagaaacgctg
cggaggaagcgcgtcgtcctgcaccgcggcacggcgctggccaccggaggcatgaacgag
atcgtcggcgtcgcgggctcgcaggcggacgtggaggtcgcgttcaaggtctcgagccta
gcgggggccgaggcactggaccccaactggctgctggacccgcagaagctgtgcggggag
aagggcgcctcggtgcccggcggcgtcgggccgttcgggctcatcgtgatggcctccagc
gacctgcgcgagcacaccgctgtcttcttccgcgcgatctacaggtaccatggcaggtac
aagcttctcatgtgcactgacctgacaaggtcgtccacgagggcaggcgtgtacaagccg
ccatacggaggattcgtggacgtcgacgttgaggagcacgagaccatcaatttgagaacc
ctgattgatcactcggtggtggagagcttcggagctgacgggcggatgtgcatcacggct
cgagtgtaccctgagcacgcggagacgagcaacagccacatgttcgtgttcaacaatggc
acaggcacggtggaggtgtccaagctcgaggcatgggagctcgcggcggcgaccgtaaat
tccgttgggggcaacgacagcttggttatgtctgaatctaatggccaaagttga

DBGET integrated database retrieval system