KEGG   Zea mays (maize): 541846Help
Entry
541846            CDS       T01088                                 

Gene name
gst37
Definition
(RefSeq) glutathione transferase37
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zma  Zea mays (maize)
Pathway
zma00480  Glutathione metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    541846 (gst37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zma02000]
    541846 (gst37)
Enzymes [BR:zma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     541846 (gst37)
Transporters [BR:zma02000]
 Other transporters
  Pores ion channels [TC:1]
   541846 (gst37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 541846
NCBI-ProteinID: NP_001152229
Position
1
AA seq 234 aa AA seqDB search
MAGREADKDPELKVLGVWSSPFVIRARVALNLKGLAYRYVEDNLDSKSELLLASNHVHGK
VPVLLHDGRPVCESRVIVEYIDEAFPASGPCLLPADPYRRAVDRFWASYVDDKLFPTWIP
VYNGRTSEDRVAAARQVVAVLEKFERAFDECSGGKAFFGGDAAGLVDVVLGGFLGWLRAS
EVMCGVRVIDPAKTPLLAAWADRFAALDGVREVIPDVQRLLEYNKIRRARRGLP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcaggacgagaagcggacaaagacccagagctgaaggtgctcggcgtgtggtcgagc
ccgttcgttatcagggcccgcgtcgcgctaaacctcaagggcctcgcctaccgatacgtg
gaggacaacctggacagcaagagcgagctcctcctcgcctccaaccacgtgcacgggaag
gtgccggtgctcctccacgacggcaggcccgtctgcgagtcccgggtcatcgtggagtat
atcgacgaggccttcccggccagcggcccctgcctcctccccgccgacccgtaccgccgc
gcggtcgaccgcttctgggcctcctacgtcgacgacaagctctttcccacctggataccc
gtctacaacggcaggacgagcgaggacagggtcgcggcggcgaggcaggtagtggccgtg
ctggagaagtttgagcgggcgttcgatgagtgctccggaggcaaggcgttcttcggcggg
gacgctgctggcctcgtggacgtcgtgctaggcggcttcctcgggtggctgcgcgcgtct
gaggtgatgtgtggcgtgagggtcatcgaccccgccaagacgccgctgctggcggcgtgg
gcggaccggttcgccgcgctcgacggcgtcagggaggtgatacctgacgtgcagaggctg
ctggagtataacaagattaggcgagctcgtcgtgggctgccgtag

DBGET integrated database retrieval system