KEGG   Zea mays (maize): 541944Help
Entry
541944            CDS       T01088                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
zma  Zea mays (maize)
Pathway
zma00670  One carbon pool by folate
zma01100  Metabolic pathways
zma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    541944
Enzymes [BR:zma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     541944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 541944
NCBI-ProteinID: NP_001292743
UniProt: A0A1D6I5L0
Position
7
AA seq 733 aa AA seqDB search
MDLRAPPTYHKTSSSIILWRRRPDAGAARRPEAINNRASKGLSRPIASPARALSVHDHHH
HHSLQRPALGRDCERAVAARSSAVVAPPPLPPPPPLPKMPSPTIRRLDVASPVPADIDIA
NSVEPLPIADIAAELGLRPEHYDLYGKYKAKVLLSVLDELKAQQDGYYVVVGGITPTPLG
EGKSTTTVGLCQALGAFLDKKVVTCLRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLT
GDIHAITAANNLLAAAIDTRIFHENSQSDKALFNRLCPANKEGKRHFADIMFRRLTKLGV
SKTDPNELTPDEIRRFARLDIDPESITWRRVMDVNDRFLRKITVGQGPEEKGMVRETGFD
ISVASEIMAVLALTTSLADMRERLGRMVIGNSKSGEPITADDLGVGGALTVLMKDAIHPT
LMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVGKGGFVVTEAGFGADIGTEKFMD
IKCRYSGLVPQCAIIVATIRALKMHGGGPEVVAGKPLDHAYVSENVALVEAGCINLAKHI
SNTRSYGVNVVVAINKFASDTEAEMKAVHSAAMAAGAFDAVVCTHHAHGGKGAVELGLAV
QRACESQAEPLKFLYPLESSIKEKIESIAKFYGASGVEYSEQAEKQIEMYTKQGFSSLPI
CMAKTQYSFSHVPSMKGAPTGFVLPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYQI
DVDTATGKVMGLS
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcgtgccccaccaacttatcacaaaacttcatcctcaattatcctatggcgt
cgtcgtcctgacgcgggggcggcgaggaggccggaggcaataaacaatcgcgccagcaag
gggctctcccgtccaatcgcatcgcctgcacgagccttatcagtccacgaccatcatcat
caccactcactgcagcggcccgcactcggccgcgactgcgagcgagccgtcgccgcgaga
tccagcgccgtcgtcgcgcctccgccactgccgccgccgccgccgctgcccaagatgccg
agcccgacgatccggaggctagacgtggcatcgccggtgccggcggacatcgacatcgcc
aactccgtcgagccgctcccaatcgccgacatcgcagcagagctcgggctccggcccgag
cactacgacctctacggcaagtacaaggccaaggtcttgctgtcggttcttgatgagctc
aaggcgcaacaggacgggtactacgtcgtggtgggcggcatcacgccaacgcccctcggg
gaggggaagtcaaccaccaccgtcgggctgtgtcaggctctcggcgctttccttgataaa
aaggttgtcacttgcctccgtcaaccatcacaagggcctacctttggaatcaagggaggt
gcagctggaggtgggtacagccaagttatacccatggatgagttcaatcttcatctgaca
ggcgatatccatgcaattacggccgcaaacaatcttcttgctgctgctattgatacgagg
atattccatgaaaattctcagtcagataaagcactgttcaacagattgtgtccggcaaac
aaggaaggcaagaggcactttgctgacataatgttccgacgtctgacaaagttgggcgtt
tcaaagacagaccccaatgagcttacaccagatgaaatcaggcgttttgcaaggcttgat
atcgaccctgagtccattacatggagacgggtgatggatgtcaatgatcgtttcctgaga
aaaattactgttggacagggccctgaagaaaaaggtatggtgagagaaacaggctttgac
atatcagtagctagtgagataatggctgtattagctcttacaacttcccttgctgacatg
agagaaaggcttggaagaatggtgatagggaacagcaagtcaggtgagccgataactgct
gatgatcttggtgttggaggtgcattgactgtcttaatgaaagatgctattcatcccacc
ctcatgcaaactcttgaaggcacaccagttttagtacatgctggaccatttgctaacatt
gctcatggaaactcttcaattgttgctgataagattgctttgaagttggttgggaagggt
ggctttgttgttactgaggcaggttttggtgctgatattggaactgagaagttcatggac
atcaaatgtaggtatagtggattggtgccgcagtgtgctattatcgtggccacaattaga
gctcttaaaatgcatggaggggggcctgaagtggtggctggaaagcctctggatcatgca
tatgtgagcgaaaatgtggcccttgttgaagctggatgtattaatcttgctaaacatata
tcaaacacgaggagttatggagttaatgttgtagttgcaatcaacaaatttgcatcagat
actgaggcagaaatgaaggcagtgcacagtgcagctatggctgctggtgcttttgacgct
gttgtctgcacacaccatgcccatggtggtaaaggagcggttgagcttggacttgctgtt
caacgagcatgcgaaagccaggcagaacctctgaagtttttgtatcccttggaatctagc
ataaaggagaagattgagtcaattgctaagttctatggtgctagtggcgttgaatattcc
gagcaggctgagaagcagattgagatgtacaccaagcaagggttctccagcctccccatt
tgcatggcgaagacccagtactcgttctcacatgtcccgtccatgaagggcgccccgacc
ggctttgttctgccgataagagacgtgagggccagcatcggcgctgggttcatctacccg
ctcgtgggcaccatgagcacgatgcctggccttcccaccagaccctgcttctaccagatc
gacgtcgacactgccaccgggaaggtcatggggctgtcatga

DBGET integrated database retrieval system