KEGG   Zea mays (maize): 541983Help
Entry
541983            CDS       T01088                                 

Gene name
pao1
Definition
(RefSeq) polyamine oxidase 1 precursor
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
zma  Zea mays (maize)
Pathway
zma00330  Arginine and proline metabolism
zma00410  beta-Alanine metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    541983 (pao1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    541983 (pao1)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     541983 (pao1)
    1.5.3.16  spermine oxidase
     541983 (pao1)
    1.5.3.-  
     541983 (pao1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox_3 GIDA FAD_binding_2 Thi4 FAD_binding_3 NAD_binding_9 FAD_oxidored Shikimate_DH HI0933_like Pyr_redox
Motif
Other DBs
NCBI-GeneID: 541983
NCBI-ProteinID: NP_001105106
UniProt: O64411
Structure
PDB: 

Position
10
AA seq 500 aa AA seqDB search
MSSSPSFGLLALAAVLLALNLAQHGSLAATVGPRVIVVGAGMSGISAAKRLSEAGITDLL
ILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYL
AQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPN
GPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYL
AGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQ
SDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVW
QEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPR
WWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAE
ILINCAQKKMCKYHVQGKYD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctccccgtcctttggtctcctggccttagcagcagtactcctagcactgaac
ttagcacaacatggctccctcgccgcaaccgtcggccccagggtcatcgtcgtcggcgcc
ggcatgtctgggatctcggcggcgaagaggctgtcggaggccgggataaccgacctgctg
attctggaagcgacggaccacatcggcgggcggatgcacaagacgaacttcgccggcatc
aacgtcgagttaggcgccaactgggtggagggcgtgaacggcggcaagatgaaccccatc
tggcccatcgtcaactccaccctcaagctccgcaacttccgctccgacttcgactacctc
gctcagaacgtctacaaggaggacggtggcgtctacgatgaagattacgtccagaagaga
attgaactggcggacagcgtggaagagatgggggagaagctctctgccactttgcacgcc
agtggcagagacgacatgtctatccttgccatgcagcgcctcaacgaacaccagccgaac
gggccggcgacgccggtggacatggtggtggactactacaagttcgactacgagttcgcg
gagccgccgcgcgtgaccagcctgcagaacaccgtgcctctcgcgaccttcagcgacttc
ggcgacgacgtctacttcgtcgccgaccagcggggctacgaggccgtcgtctactacctc
gccggccagtacctcaagaccgacgataagtctggaaagatcgtcgacccgcgcctgcag
ctcaacaaggtggtgcgagagatcaagtattccccgggtggcgtcaccgtcaagacagag
gacaactcggtgtacagcgcagactacgtcatggtttctgcgagcctgggtgtcctgcaa
tccgatctcattcagttcaagcccaagctacctacatggaaggttagggcgatctaccaa
ttcgacatggccgtgtacaccaagatcttcctcaagttccccaggaagttctggcctgaa
gggaaaggaagggagttcttcctctacgccagcagcaggagaggttactacggagtgtgg
caggagttcgagaagcagtaccctgacgccaatgtcctcctggtcaccgtgaccgacgag
gagtcgaggcgcatcgagcagcagtcggacgagcagaccaaggcggagatcatgcaggtg
ctgcggaagatgttccccggcaaggacgtcccggacgccaccgacatccttgtcccgagg
tggtggtccgacaggttctacaagggcaccttctccaactggccagttggcgtcaaccgc
tacgaatacgaccagcttagggcaccggttgggagggtatacttcaccggcgagcacacc
agcgagcactacaatggctatgtccatggagcctatctttcaggtatcgactccgctgaa
attctcatcaactgcgcccagaaaaagatgtgcaagtaccatgtccagggaaagtatgac
tag

DBGET integrated database retrieval system