KEGG   Zea mays (maize): 542075Help
Entry
542075            CDS       T01088                                 

Gene name
fie1
Definition
(RefSeq) polycomb group protein FIE1
  KO
K11462  polycomb protein EED
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zma03036]
    542075 (fie1)
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     542075 (fie1)
    PRC2-EZH2 complex
     542075 (fie1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 542075
NCBI-ProteinID: NP_001105181
UniProt: Q8VZY7 Q6J9W1
Position
4
AA seq 461 aa AA seqDB search
MPPSKARRKRSLRDITATVATGTVANSKPGSSSTNEGKQQDKKKEGPQEPDIPPLPPVVV
NIVPRQGLGCEVVEGLLVPSRKREYKPNSKYTVGNHPIYAIGFNFIDMRYYDVFAIASCN
SVIIYRCLENGGFGLLQNYVDEDKDESFYTLSWTIDQVDSSPLLVAAGSNRIIRVINCAT
EKLDKSLVGHGGSIHEIRTHASKPSLIISASKDESIRLWNVHTGICILVFAGAGGHRHDV
LSVDFHPTEVGIFASCGMDNTVKIWSMKEFWIYVEKSYSWTGHPSKFPTRNIQFPVLTAA
VHSDYVDCTRWLGDFILSKSVKNAVLLWEPKPDKRRPGEGSVDVLQKYPVPKCSLWFMKF
SCDFYSNQMAIGNNKGEIYVWEVQSSPPVLIDRLCNQECKSPIRQTAVSFDGSTILGAAD
DGAIWRWDEVDPAASSSKPDQAAAPAAGVGAGAGADADADA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgccgccttccaaagcacgccgaaagaggtcacttcgtgatatcactgccaccgttgcc
actgggactgttgccaactcgaaacctggctcatcatcgacgaacgaggggaagcaacag
gacaagaaaaaggagggtccacaggaaccggacatcccaccattaccgccggtggtggtg
aatatagtcccacgacaaggattaggatgtgaagtagtggaagggctactcgtgcctagt
cggaagcgagagtacaagcccaatagcaagtatactgtgggaaatcacccgatctatgcc
atcgggttcaatttcattgacatgcgctactatgatgtctttgccatcgccagttgcaat
agtgtgataatttaccgatgccttgagaatggtggttttggtcttctacaaaattatgtt
gatgaggataaggatgagtcattctacactctaagctggaccatcgatcaagttgatagc
tcaccgctgttggtggccgcaggaagcaatcggatcattcgggtcatcaattgtgctacc
gaaaagttagataagagcttagttggccatggtggttcaatacatgagataaggactcat
gcctcgaagccatcactcatcatttctgccagcaaggatgaatctattaggctatggaat
gtccatactgggatttgcatcttagtctttgcaggggctggaggccatcgacatgatgtg
ttgagtgttgacttccaccctaccgaggttgggatttttgcaagttgtggcatggacaat
actgtgaaaatttggtcaatgaaagaattttggatatatgttgaaaaatcatattcatgg
actggccatccatcaaagtttccaacgaggaatatccagtttccggtcttgactgctgca
gtacactctgactatgttgattgtacaagatggcttggtgacttcatcctatcaaagagt
gtaaagaatgcagttttgctttgggaaccaaaaccagacaagcgtaggcctggggagggg
agtgttgatgttcttcagaagtacccggtgccaaagtgttcattatggtttatgaaattt
tcatgtgatttttactccaaccagatggcaataggcaacaataaaggcgagatctatgtc
tgggaagtgcagtccagcccgcccgtcttaattgaccggctgtgcaaccaggaatgcaag
tcgccgataaggcagaccgcagtgtcattcgacggaagcacgatccttggagccgccgac
gacggcgcgatctggcggtgggacgaagtggaccctgctgcttccagctccaaacctgat
caagctgctgcgcccgccgccggtgtcggtgccggtgccggtgccgacgccgacgccgac
gcctga

DBGET integrated database retrieval system