KEGG   Zea mays (maize): 542473
Entry
542473            CDS       T01088                                 
Name
(RefSeq) triose phosphate/phosphate translocator, chloroplastic precursor
  KO
K15283  solute carrier family 35, member E1
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zma02000]
    542473
Transporters [BR:zma02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   542473
SSDB
Motif
Pfam: TPT EamA AsmA_1
Other DBs
NCBI-GeneID: 542473
NCBI-ProteinID: NP_001105497
UniProt: P49133 A0A3L6FLV3 A0A3L6FMR2
Position
3:1534903..1538211
AA seq 409 aa
MSALGTLSGGAAGVSGLLRLRRRAAPAPAIAAPSHLPAGTVKCAAAVPDAAPIVWGRQLR
PALLLPAALLPSLQPARRHTLQPPAAAAESAGEAKSVGFLEKYPALVTGFFFFMWYFLNV
IFNILNKKIYNYFPYPYFVSLIHLVVGVVYCLISWSVGLPKRAPINGTLLKLLFPVALCH
GIGHITSNVSFAAVAVSFAHTIKALEPFFSAAATQFILGQQVPFSLWLSLAPVVIGVSMA
SLTELSFNWTGFINAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIVCIPPALIF
EGPKLMQHGFSDAIAKVGLTKFVSDLFLVGLFYHLYNQIATNTLERVAPLTHAVGNVLKR
VFVIGFSIIVFGNKISTQTGIGTSIAIAGVAMYSYIKAKIEEEKRKKSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtcggctctcgggacgctctccggcggcgctgccggtgtctccggcctcctccgcctc
cgccgccgggccgccccagcccccgcgatcgcggcgccgtcgcacctccccgctgggacc
gtcaagtgcgcggccgccgtgcccgatgccgccccgatcgtctggggccgtcagctccgc
ccggcgctcctcctacccgcggcgctgctcccttcgttgcagcccgccaggaggcacacg
ctgcagccgcccgccgcagccgccgagtccgcaggggaggccaagtctgtgggtttcctg
gagaagtacccggccctggtcaccggcttcttcttcttcatgtggtacttcctcaacgtc
atattcaacatcctcaacaagaagatctacaactacttcccatacccatactttgtgtcc
ttgatccatctagtagtgggtgtcgtatactgcctcatcagctggagtgtcggtctcccc
aagcgagcgcctatcaatggcacgctcctcaagcttctctttccagtcgccctgtgccat
ggtattggtcacatcactagcaatgtgtccttcgctgctgttgcagtctcatttgctcac
actatcaaagctctggagcccttcttcagcgcagcggctactcagtttatccttggacag
caagttcccttctctctgtggctttctcttgcccctgtggtcattggtgtttcaatggca
tcccttactgagctttcattcaactggactggcttcatcaatgccatgatatcaaacatc
tcattcacttacaggagcatttattccaagaaagctatgactgacatggatagcaccaac
gtgtatgcttacatctcaataatcgctctaattgtttgcattccacctgcattgatcttt
gaagggcccaagctaatgcagcatggatttagtgatgccattgcaaaagtaggtttgaca
aagtttgtcagtgacctattcttggttggactgttctaccatctgtataaccagattgct
acaaacaccttggagcgagtggctcctctgacacatgctgtcggcaatgtgttgaaacgt
gtttttgtcatcggtttctcaatcattgtttttggcaacaaaattagcacacaaactgga
attggcacgtccattgccatagctggtgttgctatgtactcttacattaaggctaagatt
gaagaggagaaaaggaaaaagagcgcatga

DBGET integrated database retrieval system