KEGG   Zea mays (maize): 542651Help
Entry
542651            CDS       T01088                                 

Gene name
pdc2
Definition
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    542651 (pdc2)
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     542651 (pdc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh DUF1995
Motif
Other DBs
NCBI-GeneID: 542651
NCBI-ProteinID: NP_001105645
UniProt: Q8RUU6
Position
8
AA seq 593 aa AA seqDB search
MDTAIGSVPAASDAARHPAPSASAPRDATLGRHLARRLAEVGARDVFTVPGDFNLTLLDE
LEAEPGGVRLVGCCNELNAAYAADGYARARAGGVGACAVTFTVGGLSAINGVAGAFSENL
PVVCIVGGPNSNDYGSNRILHHTIGLPDFTQELRCFQNVTCYQAVVNNLEDAHEQIDTAI
STAIKESKPVYISISCNLPSIPHPTFSRHPVPFFLSPRLSNQMNLEAAVEAAAAFLNKAV
KPVLVGGPKMRVSKAWEALAELADACGYPVAVMPSAKGLVPVHHSRFIGTYWGAVSTPFC
AEIVESADAYLFAGPVFNDYSSVGYSLLLKKEKAIIVQPERVVVGHGPAFGCVLMKDFLH
ALATRLKKNTVAYENYRRIYVPPGEPLSSEPGEPLRVNVLFKHIQAMLSGDMAVIAETGD
SWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEV
STMLRWGQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAFHNGEGACYTAKVRT
EEELTEALEAALGPKKDCLCFIEVIVHKDDTSKALLEWGSRVSAANSRPPNPQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggacacggcgatcggctccgtcccggcagcctccgacgcggcgcgtcacccagcgccg
tccgcgtccgccccgcgcgacgcgacgctgggccggcacctggcgcggcgcctggcggag
gtgggcgcccgggacgtgttcacggtgccgggggacttcaacctcacgctcctcgacgag
ctggaggccgagccgggcggcgtccgcctcgtcggctgctgcaacgagctcaacgcggcg
tacgcggccgacgggtacgcccgcgcgcgcgccggcggggtcggcgcctgcgccgtcacc
ttcaccgtcggcggcctcagcgccatcaacggcgtcgccggcgccttcagcgagaacctc
cccgtcgtgtgcatcgtcggcggacccaacagcaacgactacgggagtaacaggatcctg
caccataccatcggcttgcctgatttcacgcaggagctcaggtgcttccagaacgtcacg
tgctatcaggctgtggtgaacaacttggaagatgcgcatgagcagatcgacactgccatc
tccacggcaatcaaggagagcaagcctgtttacattagcatcagctgcaacctcccttcg
atcccacatcccaccttcagccgccatcccgtccctttcttcctctccccaaggctatcg
aaccagatgaacctggaggctgcagtggaagccgccgcggctttcttgaacaaagccgtc
aagccagtgcttgtaggtgggccaaagatgagggtgtccaaagcatgggaagccttggca
gagctggcagatgcctgcggctatcccgttgccgtgatgccttctgcgaaggggctagtg
ccagtgcaccactctaggttcattggcacgtactggggtgcggtgagcactccattctgt
gctgagatcgtcgagtctgccgatgcctacctatttgctggccccgtattcaacgactac
agctcggttgggtactcgctgctcctcaagaaggagaaggccatcattgtccaaccagag
cgggtggtggtcgggcatggacccgcgtttgggtgtgttctgatgaaggatttccttcat
gcccttgcaacccgtctgaagaagaacactgtcgcgtatgagaactaccgtcgaatttat
gtgcctccaggcgaaccactttcatctgaacctggcgagccgttgagagtgaacgtgctc
ttcaagcatattcaggcaatgctgtccggcgacatggctgtcatcgcagagactggggac
tcgtggtttaactgccagaagctgaagctaccggaaggatgtgggtacgaattccagatg
cagtatggatcaattggctggtcagtgggcgcaactctaggatacgcacaggctgccaag
gataaacgtgtcattgcctgcattggagacggcagctttcaggtgacggcacaagaagtg
tcaacgatgctccggtgggggcagaacagcatcatcttcctgataaacaatggagggtac
acaatcgaggtggagattcacgatggcccttataacgttatcaagaactggaactacacc
ggtctggtggaagcgttccacaatggcgagggcgcgtgctacacagcaaaggttcgaaca
gaggaggagctgacggaggcgctggaggcagctctaggacctaagaaggactgcttatgc
ttcatcgaggtcatcgtgcataaggatgacaccagcaaagcgcttctcgagtggggatct
agggtttctgcggcgaatagccgtccacctaatcctcagtga

DBGET integrated database retrieval system