KEGG   Zea mays (maize): 542747Help
Entry
542747            CDS       T01088                                 

Gene name
eif3
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
zma  Zea mays (maize)
Pathway
zma03013  RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    542747 (eif3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:zma03012]
    542747 (eif3)
Translation factors [BR:zma03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    542747 (eif3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 542747
NCBI-ProteinID: NP_001105726
UniProt: Q9XHR2 A0A096RFR6 B4FGC9
Position
3
AA seq 965 aa AA seqDB search
MATFAKPENALKRAEELIHVGQKQSALQALHDLITSKRYRSWQKPLEKIMMKYVELCVDL
RKGRFAKDGLIQYRIVCQQVNVSSLEDVIKHFMQLSNEKAEQAKSQVEALEDALDVEDLE
ADKRPEDLMLSFVSGEKGKDRSDKEVVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLTAPESLQLYLDTRVEQLKV
ATELSLWQEAFRSVEDIHGLMTMVKKMPKPSILVVYYAKLTEIFWISDSHLYHAYAWLKL
FNLQKSYNKNLSQKDLQLIASSVLLAALSVSPYDKKYGAFETENEKERNMRLSNLVNFSL
DNKRENREMPSRPYLLSELASKGVLSCASQEVRDLYNLLEHEFLPLDLASKVQPLLLKIS
KIGGKLSSASSVPEVKLSQYISALEKLTTLRVLQQASCIFKSIKIDMLSRMIPFFDFSVV
EKISVDAAKQNFVAIKVDHLSGVVQFGTVDIESDGLSDHLSVLADSLNKARIHICPPVKK
PSKLGESLISLAAIVENEHKRLLARKSIIEKRKEELERQILEKEKEEEKKRMSSQKKTVD
EERVRLLNEQRQREQDRIRREIEEKNKAEAKKMLEDLNKAGKKHVVVEGELTKEAIMELA
RNEQLKERHEMEKKLQKFAKTMDYLERAKRQEEAPLIEQAFQKRLEEEKILHEQEQLREI
ELSKQHHASDLQEKNRLSRMLEHKNALQERIIQERAAEFGRLKKERDERMNRLISSRKHE
RETVRKLMFYLNLEEQRIEMLREEEEARKREAEERRKREEAERKAKLDAIAEKQRLREIE
LEEKAKATREKLLKGSEAVRAPDSAPVAQPPRESAAAPAAAAAAAAPAPAPSKYIPKFKR
GGDSSSIPSGSRDEDRWGSRGPLRQDGPPARLDAPSSRQDTDRWRGSRFPSNSTSSSSTW
SRSRN
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcgactttcgcgaaacctgagaacgcgctgaagagagccgaagaattaatccatgtt
ggtcaaaagcagtcagccctgcaggctttacatgatctcattacctcgaaaaggtacagg
tcatggcagaagcctctcgaaaagatcatgatgaagtatgtagaactctgtgttgacctg
aggaaaggcagatttgcaaaagatggtcttattcagtataggattgtctgccagcaagta
aacgtgtcatccttggaggatgtcataaagcacttcatgcagctttcaaatgagaaagct
gaacaagctaagagtcaggtcgaagcactggaagatgctctggatgtcgaagatcttgaa
gcagacaagcgtcccgaggacctcatgctcagttttgtcagtggggagaaaggaaaggac
cgatcagataaagaggttgtaactccatggtttaagttcctctgggagacatacaggact
gttctagagatactaaggaacaattcaaagcttgaagcgttatatgctatgactgctcat
agggcttttcaattctgtaaacagtataagagaacaactgaattccgtaggttgtgtgag
atcatcagaaatcatcttgctaatctcaacaaatatcgcgatcaaagagatcgtcctgat
ctgactgcacctgaaagtttacaactgtatcttgatacacgtgttgagcagcttaaagtt
gctacagaactctccctttggcaggaagccttccgatcggtggaagatatccatggtttg
atgaccatggtgaagaaaatgccaaaaccatctatcttggtggtctattatgcaaagttg
actgagatcttctggatatcggacagccacttatatcatgcgtatgcgtggctcaagctt
ttcaacttgcagaagagctacaataaaaacttgtctcagaaggatctacagttaatagca
tcttctgttttacttgctgcactatccgtgtcaccttatgacaaaaaatatggtgcattt
gagacagagaatgagaaagagcgcaacatgcgtctgtccaaccttgttaacttttcgctt
gataacaagcgtgaaaacagggaaatgccttcaagaccatatcttctatcagagttggcc
tccaaaggagtcctttcatgtgcttcccaagaagtgcgagatttgtacaaccttttggaa
catgagtttctacctctggatcttgcatcaaaagtgcagccacttcttttgaagatttca
aagattggagggaagctttcatcagcttcttctgttcctgaggtcaagttatctcagtac
atttcagcattggagaagctgacaacattgagagtgctacaacaggcctcttgtattttt
aaatccataaagattgatatgctctcaagaatgattccattctttgacttctctgtcgtg
gagaagatttctgttgatgctgccaaacaaaattttgttgctataaaagttgaccattta
tcgggagttgttcagtttggtactgtggacatagaatctgatggcttaagtgatcacctt
agtgttcttgctgattcattaaataaagcaaggattcatatctgtccaccagtgaaaaag
ccatctaaactcggtgaaagtctcattagtttggctgcaatagtggagaatgaacataag
aggctgcttgcaaggaagtccatcattgaaaaacgtaaagaagagcttgagcgtcaaata
ttggagaaggaaaaagaagaagaaaaaaagagaatgagcagtcaaaagaaaactgtggat
gaggaaagggtgaggcttctcaatgaacagaggcagagggagcaggaccggattcgtaga
gagatagaggaaaaaaataaagcagaagcaaaaaagatgctagaagatttgaataaggca
gggaaaaaacatgtcgttgttgaaggggagcttactaaggaggccatcatggaattggca
cggaatgaacagttaaaggagcgccacgaaatggagaaaaaactgcagaagtttgcaaaa
acaatggattatctggaaagggcaaaaaggcaggaagaggcaccactgattgagcaagct
tttcaaaaacgtcttgaggaagagaagatccttcacgagcaagagcagcttcgggagatt
gaactcagcaagcaacaccatgccagcgacttgcaagagaaaaatagactttcacggatg
ttggagcacaagaatgctttacaggagagaatcatccaagaacgtgcagctgagtttggc
cgtctgaagaaagagagagatgaacggatgaatcggttgatatcttcaagaaagcatgaa
agggagacagtaaggaagttgatgttttatctgaacctggaggaacagcggattgaaatg
cttcgtgaggaagaggaagctagaaaacgtgaagcggaagagaggaggaagagagaggag
gctgaaaggaaagctaaacttgatgccatcgctgaaaagcagcgattgagagagatagag
ctggaggagaaggcaaaggcaacaagggagaagctcttaaagggatccgaggctgtgcgc
gctccagattctgcacctgttgcacagccacctcgagagtcagcagcagcgcctgcagct
gctgcggcggcggctgctcctgctcctgctcctagtaaatatattcccaagtttaaacgc
ggtggtgatagcagcagcatcccttctggcagccgcgatgaagatcgctggggttcacgt
ggtccgctcaggcaagatggtcctcctgcacgactggatgcaccctcatcacggcaagat
actgatcgctggcgtggatcaagatttccctctaactcaacgtcctcttcatcaacctgg
agccgttcacggaactga

DBGET integrated database retrieval system