KEGG   Zea mays (maize): 606410Help
Entry
606410            CDS       T01088                                 

Gene name
pdi2
Definition
(RefSeq) protein disulfide isomerase 2 precursor
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
zma04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606410 (pdi2)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606410 (pdi2)
Chaperones and folding catalysts [BR:zma03110]
 Protein folding catalysts
  Protein disulfide isomerase
   606410 (pdi2)
Membrane trafficking [BR:zma04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    606410 (pdi2)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   606410 (pdi2)
  Exosomal proteins of colorectal cancer cells
   606410 (pdi2)
  Exosomal proteins of bladder cancer cells
   606410 (pdi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_2 Thioredoxin_8 OST3_OST6 AhpC-TSA ERp29_N Redoxin TraF Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 606410
NCBI-ProteinID: NP_001105755
UniProt: Q5EUE0
Position
2
AA seq 512 aa AA seqDB search
MAIRSKAWISLLLALAAVLSARAEEPAAAEAEAVLTLDVDSFDEAVAKHPFMVVEFYAPW
CGHCKNLAPEYENAAKELSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTLKIFRNQGK
NIQEYKGPREADGIVDYLKKQVGPASKEIKSAEGVAAHFDDKKIYIVGIFKEFSGTEFTN
FMELAEKLSSDYDFGHTLHANHLPRGDASVEGPLIRLLKPFDDLVVDSKDFDVAALEKFI
DASSTPRVVTFDNNPDNHPYLMKFFQSSAPKAMLFLNFSTGPLDSFKSVYYAAAEEFKDK
EIKFLIGDIEASQGAFQYFGLKEDQTPLILIQDGDSKKFLKDHIEADQIVSWLKEYFDGK
LTPFKKSEPIPEVNNEPVKVVVADNIHDVVFKSGKNVLIEFYAPWCGHCKKLAPILEEAA
TTLLSDEEVVIAKMDATANDVPSEFEVQGYPTMYFVTPSGKVTSYDSGRTADDIVDFINK
SKETASAVQATATASGKAADAAEKTEPVKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgctccaaggcctggatctcgctgctgctagcgctcgccgcggtgctctcc
gcccgggcggaggagcccgccgcggcggaggctgaggccgtgctcaccctcgacgtcgac
agcttcgacgaggccgtcgccaagcaccccttcatggtcgtcgagttctacgccccatgg
tgtggacattgtaagaaccttgctccagagtacgagaatgcggccaaggaacttagcaag
catgacccaccgattgttctcgctaaggttgatgctaacgaggagaagaacaggccgctt
gctaccaagtacgagatacaagggttcccaaccctcaagatcttcaggaaccaggggaag
aacattcaggaatacaagggccctagggaggctgatggcattgtggattacttgaagaag
caggttggccctgcgtccaaggagatcaagtcagcagaaggtgtggccgcccattttgat
gacaagaagatctatatcgttggaatcttcaaagaattcagtggcactgaatttacaaac
ttcatggagcttgctgagaagctgagttctgattatgactttggacacactttgcacgca
aaccacctcccacgtggtgatgcatctgtggaggggccattgatcaggctgctgaagcct
tttgatgaccttgttgttgacagcaaggattttgatgttgctgctctggagaagtttatt
gatgctagcagcacccctagagttgtcacttttgacaataatcctgacaaccacccatac
ctcatgaagttcttccaaagctcagctcccaaggctatgctgtttttgaacttctccacg
ggaccattggattctttcaagtctgtttactatgctgccgctgaggagttcaaggacaag
gaaatcaagttccttattggtgacattgaagccagccagggtgccttccagtactttggt
ctgaaagaggaccagacaccccttatcctcattcaggatggtgattccaagaagttcttg
aaggatcacattgaggctgaccagattgtctcttggttgaaggagtactttgatggcaaa
ttgacgccgttcaagaagtctgagcctattcctgaggtcaacaatgagcctgttaaggtt
gttgtggctgacaacatccacgatgtggtcttcaagtctggaaaaaatgttcttattgaa
ttctatgccccctggtgtgggcactgcaagaagctggcgcccatcttggaagaggcagcc
accactcttctaagtgacgaggaagttgtgattgctaagatggacgcgaccgccaatgac
gtgcccagtgagttcgaggtccaaggctacccaaccatgtacttcgtgactcccagcggg
aaggtcacctcctacgacagtggcaggacggcggatgacatcgtcgacttcatcaacaag
agcaaggagaccgccagcgccgtccaggcgacggcgacggcatctgggaaggcagctgac
gcagccgagaagaccgagcccgtcaaggacgagctgtaa

DBGET integrated database retrieval system