KEGG   Zea mays (maize): 606418Help
Entry
606418            CDS       T01088                                 

Gene name
pdi5
Definition
(RefSeq) protein disulfide isomerase 5 precursor
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
zma04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606418 (pdi5)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606418 (pdi5)
Chaperones and folding catalysts [BR:zma03110]
 Protein folding catalysts
  Protein disulfide isomerase
   606418 (pdi5)
Membrane trafficking [BR:zma04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    606418 (pdi5)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   606418 (pdi5)
  Exosomal proteins of colorectal cancer cells
   606418 (pdi5)
  Exosomal proteins of bladder cancer cells
   606418 (pdi5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_7 Thioredoxin_2 DUF2666
Motif
Other DBs
NCBI-GeneID: 606418
NCBI-ProteinID: NP_001105763
UniProt: Q5EUD0
Position
9
AA seq 529 aa AA seqDB search
MRARWAVTLLLLAVLALTASAARLDLDDDDDSGVLDELLAIDEEAERGGLLDAEGAGEAV
RRAQSMVLALDNDNARRAVEDHAELLLLGYAPWCERSAQLMPRFAEAAAALRAMGSAVAF
AKLDGERYPKAAAAVGVKGFPTVLLFVNGTEHAYHGLHTKDAIVTWVRKKTGVPIIRLQS
KDSAEEFLKKDMTFVIGLFKNFEGADHEEFVKAATTDNEVQFVETSDTSVAKVLFPGITS
EEKFVGLVKSEPEKFEKFDGKFEEKEILRFVELNKFPLITVFTELNSGKVYSSPIELQVF
TFAEAYDFEDLESMVEEIARAFKTKIMFIYVDTAEENLAKPFLTLYGLESEKKPTVTAFD
TSNGAKYLMEADINANNLREFCLSLLDGTLPPYHKSEPLPQEKGLIEKVVGRTFDSSVLE
SHQNVFLEVHTPWCVDCEAISKNVEKLAKHFSGSDNLKFARIDASVNEHPKLKVNNYPTL
FLYLAEDKSNPIKLSKKSSVKDMAKLIKEKLQIPDVETVAAPDNVKDEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggtgggctgtgacgcttctgctgctcgcggtcctagcgctcaccgcgtcg
gcggcgcggctggacctggacgacgacgacgactcgggcgtgctggacgagctcctggcc
atcgacgaggaggccgaacggggcgggctgctggacgcggagggcgccggggaggcggtg
cggcgggcgcagtcgatggtgctggcgctcgacaatgacaacgcgcgccgcgccgtggag
gaccacgcggagctgctgctgctcgggtacgcgccgtggtgtgagcgcagcgcgcagctc
atgccgcggttcgccgaggccgccgccgcgctgcgcgccatgggcagcgccgtcgccttc
gcgaagctcgacggggagcgctaccccaaggcggctgccgccgtcggggtcaagggcttc
cccaccgtgctcctcttcgtcaatggcaccgagcacgcctaccatggcctccacaccaag
gacgccatagttacttgggtaagaaagaagactggcgtgccaatcattaggcttcagtct
aaggattcagctgaggagttcctcaaaaaggacatgacctttgttattggtctattcaag
aattttgagggagcagaccatgaagaatttgtgaaggcagcaaccacagacaacgaggta
cagtttgtagaaaccagtgatacaagtgttgccaaagttctatttccaggtattacgtcc
gaggagaaatttgtgggcctcgttaaaagcgagccagagaagtttgaaaagttcgatggg
aaatttgaagaaaaggaaattttgcggtttgtggagctcaacaagtttcctctaattact
gtattcactgagctcaattctggtaaagtatattcaagccctattgagctacaggtcttc
acctttgcagaggcttatgattttgaagatctggaatctatggttgaagaaatagccaga
gcattcaagacaaagataatgtttatatatgttgacactgctgaagaaaaccttgcaaaa
ccattcctcactctttatggccttgaatcagaaaaaaagcctactgttacagcatttgat
acaagcaatggagccaagtatctgatggaggcagatatcaatgcaaacaacctgagggag
ttctgcttaagtcttctggatggcacgctcccgccataccacaaatcagaaccattgcct
caagagaagggacttattgaaaaggttgttggtcgtacatttgattcttctgtgctggaa
agtcatcaaaacgtcttccttgaggttcatacaccttggtgtgttgactgtgaagcgata
agtaaaaatgttgagaagctggcgaagcattttagtggttcggacaatcttaaatttgcg
cgcatagatgcttctgtgaatgaacatcccaaattgaaggtgaataattacccgacgcta
ttcctttatcttgctgaagacaaaagcaacccgatcaagctttcaaagaaatcgagtgtc
aaggacatggccaaactgatcaaggagaagctgcaaataccagacgtggagacagtagcg
gcccctgacaacgtcaaggatgagctataa

DBGET integrated database retrieval system