KEGG   Zea mays (maize): 732804
Entry
732804            CDS       T01088                                 

Gene name
bt1
Definition
(RefSeq) adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial precursor
Organism
zma  Zea mays (maize)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 732804
NCBI-ProteinID: NP_001105889
UniProt: B4F832
Position
5
AA seq 437 aa
MAATMAVTTMVTRSKESWSSLQVPAVAFPWKPRGGKTGGLEFPRRAMFASVGLNVCPGVP
AGRDPREPDPKVVRAADNCDIARQLGAAVPGQQAAWEAEEEAAKRRKQKGGGSKKQQQLG
DLSLRKVRVKIANPHLRRLVSGAIAGAVSRTFVAPLETIRTHLMVGSIGVDSMAGVFQWI
MQNEGWTGLFRGNAVNVLRVAPSKAIEHFTYDTAKKFLTPKGDEPPKIPIPTPLVAGALA
GFASTLCTYPMELIKTRVTIEKDVYDNVAHAFVKILRDEGPSELYRGLTPSLIGVVPYAA
CNFYAYETLKRLYRRATGRRPGADVGPVATLLIGSAAGAIASSATFPLEVARKQMQVGAV
GGRQVYQNVLHAIYCILKKEGAGGLYRGLGPSCIKLMPAAGIAFMCYEACKKILVDKEDE
EEEDEAGGGEDDKKKVE
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcggcgacaatggcagtgacgacgatggtgacgaggagcaaggagagctggtcgtca
ttgcaggtcccggcggtggcattcccttggaagccacgaggtggcaagaccggcggcctc
gagttccctcgccgggcgatgttcgccagcgtcggcctcaacgtgtgcccgggcgtccca
gcggggcgcgacccgcgggagcccgatcccaaggtcgtccgggcggccgacaactgcgac
atcgcgcgccagcttggcgccgccgttcccgggcagcaggccgcctgggaggcggaggaa
gaggcagcgaagaggaggaagcagaagggcggcggcagcaagaagcagcagcagctgggc
gatctgagcctgaggaaggtcagggtcaagatcgccaacccgcacctgcggcgcctggtt
agcggcgccatcgccggcgccgtgtccaggacgtttgtggcgccgctggagacgatccgg
acgcacttgatggtcggcagcatcggcgtcgactccatggccggggtgttccagtggatc
atgcagaacgaagggtggaccggcctgttccgcggcaacgccgtcaacgtcctgcgcgtc
gctccgagcaaggctatcgagcatttcacctatgacacggccaagaagttcctaaccccc
aagggcgacgagccgcccaagatcccgatccccactccgctggttgccggagctctagcc
ggattcgcctcaaccttgtgcacctaccccatggagctgatcaagaccagggtcaccatc
gagaaggacgtatacgacaacgtcgcgcacgcgttcgtgaagatcctacgcgacgagggc
ccgtcggagctgtaccgtgggctgacacccagcctgatcggcgtggtgccgtacgcggcc
tgtaacttctacgcctacgagacgctgaagcggctctaccgtcgcgcgaccgggcggcgt
cccggcgcggacgtgggccccgtggcgacgctgctcatcgggtccgcggcgggcgccatc
gccagctcggccacgttcccgctagaggtggcccgcaagcagatgcaggtgggcgctgtg
ggcgggaggcaggtgtaccagaacgtcctccacgctatctactgcatcctcaagaaggag
ggcgccggcggcctgtaccgaggtctcggccctagctgcatcaagctcatgcccgccgcc
ggcatcgccttcatgtgctacgaggcgtgcaagaagatcctcgtcgacaaggaggatgag
gaggaggaggacgaagccggcggcggagaggatgacaagaaaaaggttgaatga

DBGET integrated database retrieval system