KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0229Help
Entry
ZZ6_0229          CDS       T02187                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00450  Selenocompound metabolism
zmb00970  Aminoacyl-tRNA biosynthesis
zmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ZZ6_0229
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ZZ6_0229
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmb01007]
    ZZ6_0229
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zmb03016]
    ZZ6_0229
Enzymes [BR:zmb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ZZ6_0229
Amino acid related enzymes [BR:zmb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ZZ6_0229
Transfer RNA biogenesis [BR:zmb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ZZ6_0229
 Prokaryotic type
   Other AARSs
    ZZ6_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Glyco_hydro_127
Motif
Other DBs
NCBI-ProteinID: AFN56133
Position
complement(264200..265765)
Genome map
AA seq 521 aa AA seqDB search
MSQSFYITTAISYPNGKPHIGHAYEAIASDALARYHRLAGDDVYFQTGTDEHGLKMAQTA
RNRDIEPIVLANEMSSHFKTMDDFYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLG
RYEGWYSIRDEAFYKEEELVTDSKGEKLSPQGTPVEWNVEESWFFRLSAFQDKLLAYYEA
HPDFIQPEARRNEVISFVKSGLADLSISRTSFDWGIPVPDSPGHVMYVWIDALTNYLTGA
GYPDNKERFDRYWPADIHVIGKDIIRFHAVYWPAFLMAADIALPKKVFGHGFLLNRGEKM
SKSVGNVVDPIDMAKLYGIDQIRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQ
RSLSIIAKNGAKVPSPEDTRAEDQALMEKIAGIPHQVATAMNNVAPNQALDAIWRGVGEA
NLYISEQAPWTVRKTDPVRADTILYWTIEAVRQLAILCRWAMPASCDALLDLLGQGADQR
DFRALSAPLVPGLPLPKPVGVFPRFVDNDKNNSEKAAKDKA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatctttttatattacgacggctatcagttatcctaatggcaagcctcatatt
ggtcatgcctatgaagctatcgcatcggatgcgcttgcccgttatcatcgtttggcagga
gatgatgtctatttccagaccggaacggatgaacacggtctaaaaatggcacagactgcc
cgcaatcgtgatatcgaaccgatcgttcttgccaatgagatgtcttcccatttcaagaca
atggatgatttttacaatatctcctatgaccgttttatccgcaccaccgaagcggaacat
tacaaagctagtcaggccttgtggaaaaccttggctgatgcgggtcatatctatctggga
cgctatgaaggctggtattctatccgtgacgaggctttttataaagaagaagagctcgta
accgattccaagggcgaaaaactgtcaccgcaaggcacgcctgttgaatggaatgtcgaa
gaaagctggtttttcagactgtccgcttttcaggataaattattggcctattacgaagcc
catcctgattttatccagccggaagcccgtcggaatgaagtaatcagtttcgttaaatcc
ggtttagccgatctttccatctccagaaccagctttgattggggtattcctgttccggat
tcccctggacatgtcatgtatgtctggattgacgctttaaccaactatctgacaggtgct
ggttatcctgataacaaagaacgttttgatcgttactggccagccgatatccatgttatt
ggtaaggatattatccgttttcacgcggtttattggccagccttcctaatggcggccgat
attgctttaccgaaaaaagtttttgggcatggtttcctcctgaatagaggggaaaagatg
tctaagtcggtcggtaatgtggtcgatcccatcgacatggcaaagctttatggtattgat
caaatccgctattttctgctgcgggaagtaacctttggtcaagatggcagctatagtcat
gaagcgattgtaaaccgaatcaatgccgatctcgccaatgatttcggtaatttggcacag
cgttccttatccatcattgccaaaaatggtgcaaaagtgccaagcccagaagatacgcgc
gccgaagatcaggctttaatggaaaagattgccggtattccgcatcaggtcgcaacggcc
atgaataatgttgcccccaatcaggctttggatgcaatttggcgcggagttggtgaagcc
aatctttatatttcggaacaggcaccttggacggtcagaaaaacagacccagtccgtgcc
gatactattctatattggacaattgaagcggtacggcagctggctattttatgccgttgg
gctatgcctgccagctgtgatgccttgcttgatttattagggcagggggctgaccagcgt
gatttccgtgctttatctgcgccattagttccgggattaccgctcccgaaaccggtcggt
gtattccctcgttttgtcgataatgacaaaaataattcggaaaaagcagccaaggataaa
gcctga

DBGET integrated database retrieval system