KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0463Help
Entry
ZZ6_0463          CDS       T02187                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00471  D-Glutamine and D-glutamate metabolism
zmb00550  Peptidoglycan biosynthesis
zmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ZZ6_0463
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZZ6_0463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmb01011]
    ZZ6_0463
Enzymes [BR:zmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     ZZ6_0463
Peptidoglycan biosynthesis and degradation proteins [BR:zmb01011]
 Precursor biosynthesis
  Amino acid ligase
   ZZ6_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFN56362
Position
complement(534439..535764)
Genome map
AA seq 441 aa AA seqDB search
MITSPVFSGQFYAVLGLARSGMATVAALLASDAKVMAWDNNPETRDRLQQQYQEAIDKGR
LVIADPMIADIFGISAFVVSPGIPINRHPIAALAKERGIPIIGDIELFAQAHGFWERHRR
RCPVVGITGTNGKSTTTALIHHILKEAGVPTLMGGNIGLPLLAADPLPDGGVYVLELSSY
QIDLTFTLDCDIAVLTNITPDHLDRHGGFEGYRKAKERLFLLQSSPHYAVIATDDIPSQV
IAKQSAAHLVTVHADNISAEDQVNWPNLQGPHNAQNAVLAMAVAHILGISDAVISKALVS
YAGLPHRMQKIGERRGVLFIDDSKATNAMATAPALAAFPAIHWILGGVPKTADLDPCKAF
YNHIRQAYTIGQAGPDYAQLLREAGVNVVECGTLEKAVRLAAEEAQPDEVVMLTPACASF
DQFSDYEARGQAFRKIVEALD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattactagccctgttttttccggtcagttttatgcggttttaggccttgcccgatca
ggcatggccactgtggctgcccttttggcatcagatgccaaggtgatggcttgggataat
aatcctgaaacccgcgatcgactgcaacagcaatatcaagaagcgattgataaaggacgg
ctggttattgccgacccgatgattgctgatatttttggcatatcggcctttgtcgtctct
cctggtatcccaatcaatcgtcatccgattgccgctttggcgaaagaacgcggtatcccg
attattggcgatattgagttatttgcccaagcccatggattttgggaaagacatagacgg
cgttgccccgttgtcggcattaccggaacaaatggtaaatcgacgacaacagcgcttatc
catcatattttgaaagaggcgggtgtcccgaccttgatgggtggtaatattggtttgcct
ttattagcggcagatcctttgcccgatggtggggtctatgtgttggaattatccagctat
cagattgatctgacctttacccttgattgcgatattgcggttttgaccaatattacgccg
gatcatctcgatcggcatggcggttttgaaggttatcgcaaagcgaaagaacggctattt
ttactgcaatcatcgccacattatgccgttattgcaacggatgatatccctagtcaggta
attgccaagcagtcggctgcccatttggtgacggtgcatgctgataatatttcggcagaa
gatcaggtgaattggccgaatttgcaggggcctcataatgctcaaaatgctgttttagcg
atggccgttgcccatattctgggtatctcggatgctgttatttcaaaagccttggtcagt
tacgcgggattgcctcatcggatgcaaaaaatcggtgagcggcggggtgttttgtttatt
gacgattccaaagcgaccaatgccatggcaacagcccctgctttggcggcttttccggcg
atccactggatattgggaggagtgccgaaaacagctgatcttgatccttgcaaagccttc
tataatcatatccgtcaggcctatacgattggtcaggcgggtcctgattacgcgcaatta
ttgcgtgaagcgggggtgaacgttgtggaatgtggcacccttgaaaaggcagtgcgtttg
gcagcggaagaagcccagcctgatgaagtcgttatgttgaccccggcttgcgcctctttt
gaccagtttagcgattatgaggcgagaggacaggcctttagaaaaatagtggaggcgctt
gattaa

DBGET integrated database retrieval system