KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1004Help
Entry
ZZ6_1004          CDS       T02187                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00330  Arginine and proline metabolism
zmb00332  Carbapenem biosynthesis
zmb01100  Metabolic pathways
zmb01130  Biosynthesis of antibiotics
zmb01230  Biosynthesis of amino acids
Module
zmb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZZ6_1004
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ZZ6_1004
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ZZ6_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA GerE
Motif
Other DBs
NCBI-ProteinID: AFN56894
Position
1147728..1148921
Genome map
AA seq 397 aa AA seqDB search
MVADLTSDISESQEQETETNSANNNGAVFRPENCPRLVIKIGSSLLVDQRGQVRRDWLQT
VAYDIAKLHQAGQQIIVVSSGAIALGARRLNLPRGGRASLEDAQASASVGQILLSQCWAE
LLGACSLDSSQILLTLDDLEDRRRYLNVSATLDRLLSLGVVPVINENDSIATAEIRFGDN
DRLAARIGQASHASGVILFSDVDGLYTANPMKDPNAKRIDRVEHIDNSTEAMASSDSASG
MGSGGMASKVEAARIATYSGVNLAITTGKRPSPLTMFLNDGAGTLFTADESASAHKTWLA
GRLTAHGQVYIDQGAVEALHDGNSLLPAGVCSIEGKFNRGDVVDILDQEHNLIARGLIEY
DSEDSAQITGKRSQEIADILGYEARTALIHRNHMVML
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctaacttctgatatttcagaatcccaagagcaagaaacagaaactaac
tctgccaataataacggcgcggttttccgaccggaaaactgcccgcgactggttataaaa
attggttcttctttgctcgttgaccaacgcggtcaagttcgtcgcgattggctgcaaact
gtcgcctatgacattgccaaattgcatcaagctggacagcaaatcattgttgtttcctca
ggcgctattgcccttggagccagacgcttgaacttgccacgcggtggacgggcttcctta
gaagatgctcaagcctcggcttctgtcggacaaattttgcttagccaatgctgggcagaa
ttgctgggtgcatgcagcttggattcatcccaaattctactgacactggatgatctggaa
gatcgccgccgctatctgaacgtctcggctacgcttgatcgcctgctttctcttggtgtc
gtgccagtcatcaatgaaaatgactcgattgcgaccgcagaaattcgttttggagataat
gaccgtctcgccgctcgcatcgggcaggccagccatgcctctggcgttatcctcttttca
gatgtggatggcctttacacggccaacccaatgaaagatcccaacgccaaacggattgat
cgggtcgaacatatcgacaatagcacagaagctatggctagcagtgattccgcttccggt
atgggttctggcggcatggcttccaaggtagaagcagcgcgtatcgctacctattccggt
gttaatctcgcgattacaacgggtaaacgcccttccccgctgacgatgtttttgaatgat
ggtgctggcacgctattcacagccgacgaaagcgcttcagctcataaaacatggctggcc
ggacgattaaccgctcatggtcaggtttatatcgatcaaggtgcggtcgaggcactccat
gatgggaacagcctgctccctgcgggcgtctgctccatagaaggcaaattcaaccgcggt
gacgtggtcgatatcctcgatcaagaacacaaccttattgcacggggtctgatcgaatat
gacagcgaagattctgcccaaatcacaggcaagcggtcgcaggaaattgctgatattcta
ggatatgaggccagaacagccctaatccatcgcaatcatatggttatgctatga

DBGET integrated database retrieval system