KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1268Help
Entry
ZZ6_1268          CDS       T02187                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00860  Porphyrin and chlorophyll metabolism
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZZ6_1268
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ZZ6_1268
Exosome [BR:zmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZZ6_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFN57148
Position
complement(1445461..1446462)
Genome map
AA seq 333 aa AA seqDB search
MSLVATQYPATRLRRLRASAWSRSMHSENVLTPADFIWPLFVTGGKGVKEAVQSMPGVFR
WSVDLIVEQAKLAHSLGIPCLALFPNTDIAKRSEDGREAWNADNLMCQAIRAIKDAVPDI
GLLTDVALDPYTSHGHDGVIDAQGYVLNDETKELLIKQARVQAEAGADIIAPSDMMDGRV
AAIRDMLESEGHRNVQIMSYAAKYASVFYNPFRDAVGSAGIFKADKKTYQMDPANSDEAL
REVAMDIAEGADSVMVKPGLPYLDVLYRVKESFKLPVFAYQVSGEYAMLEAAFAAGMLDK
DKAVLETLTCFKRAGAAGVLTYHAVHAAKLLNG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagtcgctacacaatatccggcaacgcgcctgcgtcgcctccgtgcttccgct
tggagccggagcatgcattccgaaaatgttttgacccctgccgattttatctggccgtta
ttcgtgacgggtgggaaaggcgtgaaagaggccgttcaatctatgcccggcgttttccgc
tggtctgttgatctgattgtcgaacaagccaaattagcccacagcctcggcatcccctgt
ctggccttattcccgaataccgatatcgccaaacgcagcgaggatggtcgggaagcatgg
aatgctgataatctgatgtgtcaggctattcgcgccatcaaagacgcggttcccgatatc
ggcttgttaaccgatgtcgccttggatccttataccagccatggtcacgatggcgttatt
gatgcgcagggctatgttctgaatgacgaaaccaaagaattactgattaaacaggctcgg
gttcaggccgaagccggtgccgacattattgctccttccgatatgatggatggacgggtt
gccgctatccgcgacatgctggaaagcgaaggccatcgcaatgtccagatcatgtcctat
gccgctaaatatgcgagcgttttttataatcccttccgtgatgcggtgggttcggctggt
attttcaaagctgacaagaaaacctaccaaatggatccggccaatagtgatgaagccttg
cgcgaagtcgctatggatatcgcagaaggcgcagacagcgtcatggtcaaaccgggtctg
ccttatctcgatgtgttatatcgcgtaaaagaaagctttaaattgccggtcttcgcctat
caggtctctggtgaatatgcgatgttagaagccgcctttgcagccggtatgctcgacaaa
gataaggccgttctcgaaaccctaacctgcttcaaacgcgccggagccgcaggtgtttta
acctatcatgcggttcatgcggcaaagcttttgaatggctaa

DBGET integrated database retrieval system