KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: A265_01253Help
Entry
A265_01253        CDS       T03385                                 

Definition
(GenBank) putative pyridoxal phosphate-dependent acyltransferase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
zmc  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmc00780  Biotin metabolism
zmc01100  Metabolic pathways
Module
zmc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:zmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A265_01253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmc01007]
    A265_01253
Enzymes [BR:zmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     A265_01253
Amino acid related enzymes [BR:zmc01007]
 Aminotransferase (transaminase)
  Class II
   A265_01253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SHMT Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHJ72717
Position
1431661..1432770
Genome map
AA seq 369 aa AA seqDB search
MISALSDNQLLCDFSSNDYLGLSSHPLLKERSQLWTDQFGVGSRASRLVSGTLPIHLEVE
KKVALLKGKEAALLFPSGWQANASVLPALFRLSLEQTGHKALVFTDKLNHASIHLGCSAA
GIKQIRFRHNDLPHLEQLLEKQKQVDGLRFIITESVFSMDGDQAEIGTLRQIADKYNAFL
YVDEAHATGVLGENGQGLAGGANGADLVMGTFSKALGCFGAYIAGSTLLCDWLVNSCSGF
IYSTAMPPSMIGAMDAALDILPTLSKERKQLIERSNHIRKEFQSMGLDTGLSSTHIIPVM
IGNNEATLLAAQRLKDEGILAIAIRPPTVPLHAGRLRFAITSLHNDAMLEHLSHVMKKLA
AEIHRGSSI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgctctttctgataatcagcttttatgcgacttttcttctaatgattacctt
ggtctttcttcccatcctctcctaaaagaacgatcccagttatggacagatcaattcggg
gttggctctcgggcttcgcgtctggtttctggaacactaccgatacatcttgaagtcgaa
aaaaaagtggctcttttaaaaggcaaggaagcggctttactctttccatctggctggcaa
gctaatgcttcagttttacccgccttatttcgactctcgcttgaacaaactggtcataag
gctcttgtttttacggataagctaaatcatgcaagtatacatcttggatgctccgctgcc
ggtatcaagcaaatccgatttcgtcataatgatttgcctcatttagaacagcttctagaa
aaacaaaaacaggtagatggactccgctttattataaccgaaagcgtttttagtatggat
ggcgatcaggcagagatcggaacgcttcgtcaaatcgctgataaatataatgcctttctc
tatgtggatgaagcccatgcaacaggtgttctcggagaaaatggccaagggcttgctgga
ggcgctaacggggctgatttggttatgggaacatttagtaaggcgttaggctgctttgga
gcttatattgcaggatccacgttgctttgtgattggcttgtgaatagctgttctggattt
atctatagcacagctatgccgccatcaatgattggggcaatggacgctgctttggatatt
cttccgactttgtcaaaagaacgcaaacaacttattgaaagatcgaatcatatccgaaaa
gaattccaatctatggggttagatactggcttatcttctacccatattattcctgttatg
atcggtaataatgaagccaccttgttggctgcgcaaagattaaaagatgagggtattctc
gctattgcaatccggcctcccactgtgccgcttcatgctggacgtcttcgctttgctata
acctctcttcataacgatgccatgctagaacatctgagtcatgttatgaaaaaattagcg
gctgaaatacacagaggatcttcgatatga

DBGET integrated database retrieval system