KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: ZCP4_0069Help
Entry
ZCP4_0069         CDS       T02932                                 

Definition
(GenBank) serine palmitoyltransferase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
zmi  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmi00780  Biotin metabolism
zmi01100  Metabolic pathways
Module
zmi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:zmi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ZCP4_0069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmi01007]
    ZCP4_0069
Enzymes [BR:zmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     ZCP4_0069
Amino acid related enzymes [BR:zmi01007]
 Aminotransferase (transaminase)
  Class II
   ZCP4_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHB09407
Position
complement(79300..80511)
Genome map
AA seq 403 aa AA seqDB search
MQVTDLFSKFDPLIAIRKEMLSHGGRDPFAVVMEKVLSPTKAIIKGKPVILLGTYNYMGM
TFDPDVIAAGEKALKEFGAGTTGSRVLNGTYQGHKACEEALKDYYGMEHAMVFSTGYQAN
LGMISTLAGKGEYVIIDADSHASIYDGCRLGNAEIIRFRHNSPEDLDRRLARLPKEAGKL
VVLEGVYSMLGDIAPLAEMVAIAKKHDALILDDEAHGMGFFGKNGRGVFEELGLEGQIDF
IVGTFSKSVGTVGGFCVSNHPQFEVLRLVCRPYVFTASLPPSVVATAEASIRKLQKANDK
REHLWKNSRRLHGGLKEMGFKLGTETAQSAIIAVILPDQEQAVAMWQNLLELGLYVNLAR
PPATPAGMFLLRCSLCAEHSDDDVTEILAMFKKAGQATGVLAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtgactgatcttttttcaaaatttgacccgctgattgctatccgtaaggaaatg
ttaagtcatggcggccgtgatccttttgccgtggtgatggaaaaggtattatccccgaca
aaggccattattaaagggaagccggttatcttgcttggcacctataactatatggggatg
acttttgaccccgatgttattgctgccggtgaaaaggcattaaaagaattcggcgcaggc
accaccggttctcgcgttttaaatggcacctatcaggggcataaggcctgtgaagaagcc
ttgaaagactattacggtatggaacatgccatggtcttttcaaccggatatcaggccaat
cttggtatgatttcgactttggcgggcaaaggcgaatatgtcattatcgacgccgatagc
catgcttcgatttatgatggctgccgtcttggcaatgcagaaatcatccgttttcgtcac
aattctcccgaagatcttgatcgtcgtcttgcccgtttacccaaagaagcaggcaaactc
gttgttttggaaggcgtttattcaatgctgggcgatattgcgcctttggcagagatggtt
gccatcgccaaaaagcacgatgccttgattcttgatgatgaagctcatggtatgggattc
tttgggaaaaacggccgtggtgtctttgaagaattggggcttgaaggtcagattgacttt
attgtcggcactttttcaaaatcagtcggcactgttggcggtttctgtgtttccaaccat
cctcaatttgaagtgctgcgtttggtatgccgtccttatgtctttacggcgtctttgccg
ccaagtgtggtcgctaccgcagaggcgtctatccgcaaacttcaaaaggccaatgacaag
cgggaacatctttggaagaactcccgtcgtttgcatggcggcctgaaggaaatgggtttc
aagctgggaacggaaacagcccaatcggcaattattgcggtcatcctgccggatcaggaa
caagccgttgccatgtggcaaaatctgcttgagctgggtctttatgtcaatctggcacgc
ccaccggcaacgcctgccggtatgttcttgctgcgttgttcgctttgtgccgagcatagc
gacgatgatgtcactgaaattctggcgatgttcaaaaaagccggtcaagcaactggcgtt
ttggcggcctga

DBGET integrated database retrieval system