KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: ZCP4_0354Help
Entry
ZCP4_0354         CDS       T02932                                 

Definition
(GenBank) N-acetylglucosamine 6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
zmi  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Pathway
zmi00520  Amino sugar and nucleotide sugar metabolism
zmi01100  Metabolic pathways
zmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZCP4_0354
Enzymes [BR:zmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     ZCP4_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AHB09679
Position
397955..399100
Genome map
AA seq 381 aa AA seqDB search
MQLAFTHGQIVTPDTILTDHSLLIENGVIKAITDQPLPCDIPTIDLHHQILLAGFIDIQV
NGGGGCLFNDHPDVNSISKIAAAHRAFGTTSLLPTLVSEETTVIKKAVHAIEDAIQAGIK
GIVGLHIEGPFIAMTRRGIHAASKIRPISEEDINFLCDSARKNKDNFRILLTLAPETMDA
SIITKLTEAGVIVSIGHSDSDYETAMKAVKAGASGFTHLFNAMSQNTSRAPAVVGAALDS
DNSYAGIIADGEHVHPSNIRLAYKAKGADHLMLITDAMPLTGWEEDHFLLQGQMIYRRDG
RITDDKNVLAGSLLDTATAFANMVKMTDISLVEASRMASLTPARFLGLQDRGSIEIGKRA
DLVVMNESLKLQSVWISGEKY
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgcctttacgcacggacaaatcgttacaccagatacgatattgaccgatcac
agtctgttaatcgaaaatggcgtgataaaagccattaccgatcaaccgctgccttgcgat
atcccaaccatagacctgcatcatcagatccttttggcaggctttattgatattcaggtt
aacggcggtggcggctgcctttttaacgatcatcctgatgtaaactctatttcaaaaatt
gcggcggcacatcgtgcttttggcaccacatctttactaccgactttggtcagtgaagag
acgacagtgatcaaaaaagccgttcatgccattgaagacgctattcaggctggcattaag
ggcattgtcggccttcatatcgaagggccttttattgcaatgacgcggcgtggcatccat
gcagccagcaaaattcgtccgatcagtgaagaagatatcaacttcttatgcgacagcgcc
cgaaagaataaggataatttccgaattctcctgaccttagcaccggaaacaatggatgcc
tcaatcatcaccaagctgacagaggctggagtgattgtttctatcggtcattcggacagt
gattacgaaaccgccatgaaagcggtcaaggctggcgcaagcggctttacccatttattt
aatgccatgtctcaaaataccagccgtgcgcctgccgttgtcggtgccgccttggatagc
gataacagctatgcgggcattattgctgacggggaacatgtccatccgtcaaatatccgt
cttgcttacaaggcaaagggcgctgaccatttaatgttgataaccgatgccatgccctta
acgggatgggaagaagatcatttcctgttgcagggacagatgatctatcgccgcgatggc
cggattaccgatgataaaaacgtgctggcaggttctctgctcgatacggcaacggctttt
gccaatatggtcaaaatgacggatatttccttggttgaggcctctcgtatggcctctctg
accccagcccgttttctaggactgcaagatcgcggcagcatagaaatcgggaaaagagct
gatctcgttgttatgaatgaatcgctaaaactgcaatccgtctggatatccggcgaaaaa
tactag

DBGET integrated database retrieval system