KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0508Help
Entry
Zmob_0508         CDS       T01875                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00970  Aminoacyl-tRNA biosynthesis
zmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Zmob_0508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zmm03029]
    Zmob_0508
Enzymes [BR:zmm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Zmob_0508
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Zmob_0508
Mitochondrial biogenesis [BR:zmm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Zmob_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEH62354
UniProt: A0A0H3FX27
Position
591656..593134
Genome map
AA seq 492 aa AA seqDB search
MTRLTDLGVTDLRDGIAKGDFSAKEVAESFLTATNEAEKLNAFITLTPDHALKQAEKADK
DRASGQLKPLSGVPLGIKDLFCTNGYRTTAASKIIDNFVPPYESTITEKLFSAGAGMVGK
LNLDQFAMGSSNETSAFGNVISPWRQKGDDTALTPGGSSGGSAAAVAAKLVPAATGTDTG
GSIRQPASFTGITGLKPTYGRCSRYGVIAFASSLDQAGPMAHSVKDCAALLEVMAGFDPK
DSTSVDVMVPNWEKLLSSDIRGKKIGIPKEYRVDGMAPEIESLWQRGIDMMKDAGAEIID
VSLPHTQHALAAYYIIAPAEASSNLARYDGVRYGERKTPEGGNLADMYAATRAAGFGDEV
KRRIMIGTYVLSAGFYDAYYIKAQKIRALIARDFEAAFDKCDILLTPATPTAAFALGQKQ
EDPIAMYLNDVFTVPASLAGLPAMTVPVGLNEQGLPLGLQLIGKPLDEQSVLNAGLALEE
RAGFTSQPKKWW
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcttacagatcttggtgttacagatttacgcgatggtatcgcaaaaggtgac
ttttcagcgaaagaagtcgctgaaagctttctgactgccaccaatgaagctgaaaagctg
aatgcttttatcacgctcacccctgaccatgctttaaaacaggctgaaaaggctgacaaa
gaccgcgcctccggccagttaaaaccgttatccggtgtgccgctcggtatcaaagacctg
ttttgcaccaacggctatcgcaccactgcggccagcaaaattatcgacaattttgtgccg
ccttatgaatccacgattactgaaaagttattctcggcaggtgctggcatggtcggcaaa
ctgaatcttgaccagtttgctatggggtcttccaatgagaccagcgccttcgggaatgtc
atttctccttggcggcaaaagggcgatgacacggccttaacgccgggcggttcttccggt
ggttcggcagcagccgtcgccgctaaactcgttccggccgccaccggtaccgataccggc
ggctccatccgtcagcccgcttctttcaccggcatcacgggcttaaagccgacctatggc
cgttgctcccgttacggggttatcgcctttgcctcctcgctcgatcaggcaggtcccatg
gctcattctgtcaaggattgcgccgctttactcgaagtcatggcgggtttcgatcccaaa
gattccacttctgtcgatgtgatggtgccgaattgggaaaaactgctttcctctgacatt
cgcggcaaaaaaatcggtattccaaaagaatatcgcgtggatggcatggcgcccgaaatc
gaaagtttatggcagcgtggcatcgacatgatgaaggatgcgggtgccgaaattattgat
gtaagcctgccccatacgcaacatgctttggcggcttattatatcattgctccggcggaa
gcctcctctaacctcgcccgttacgacggtgttcgctatggtgaacgcaaaacgccggaa
ggtggcaatctcgcggatatgtatgccgcgaccagagcggctggtttcggtgacgaagtc
aaacgccggattatgatcggtacctatgtgctgtctgccggtttctatgatgcctattat
atcaaggcacagaaaatccgtgctttaattgcccgcgattttgaagccgcttttgacaaa
tgcgatattctgctgactcctgcaacgccaacagctgcctttgcccttggtcaaaagcaa
gaagatcccatcgcgatgtatctgaacgatgtcttcacagttccggcttctttggcgggt
ctccctgcaatgacggtgccggttggccttaatgaacagggtctgccgcttggtttgcag
ttgatcggcaagcctttggatgaacagagcgtgttaaatgctggccttgctctcgaagag
cgcgccggatttaccagccagccaaagaaatggtggtaa

DBGET integrated database retrieval system