KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0966Help
Entry
Zmob_0966         CDS       T01875                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00220  Arginine biosynthesis
zmm00330  Arginine and proline metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01130  Biosynthesis of antibiotics
zmm01230  Biosynthesis of amino acids
Module
zmm_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Zmob_0966
   00330 Arginine and proline metabolism
    Zmob_0966
Enzymes [BR:zmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Zmob_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEH62801
UniProt: A0A0H3G281
Position
complement(1135197..1136069)
Genome map
AA seq 290 aa AA seqDB search
MSSINKPLRLIFPQWQGGDNPPYYLGSQLLAWLSPDPKGAVEEVPVPKPTGEPLQEENGI
VGRSILIDQLSKARQLIEKHTPDSLVVLGGDCLVSLAPFSWLLEKYKDKLGILWIDSHPD
VQTPKEYKNAHAHVLGELMGNGDSDFTRTVKHPVSPQKIMIAGIHDPLPYEANFISEHKI
QTCSPEQVRSGAQPVLDWIKNEKIEYLAIHIDLDVLDPHNFRSVLFAKPGRGQHDFGDVA
EGKLNIPDVVKLANQAASISKAVGLTIAEHLPWDALNLKNMLEELPLIGK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattaataaaccgttgagactcattttcccgcaatggcaaggtggtgataat
cccccttactatttgggttcgcagcttttggcgtggttatcgcctgatcccaaaggcgcg
gttgaagaagtgcctgttccaaaaccaacaggagaaccgctgcaagaagaaaatggcatt
gttgggcggtcaattttaatagatcagctatcaaaagcgcggcagttgatcgaaaagcac
acaccagattctctagttgtcttaggcggtgattgccttgtttctttagcacccttctca
tggcttcttgaaaaatataaagataagttagggattctttggatcgattcacatccagat
gttcaaacgcccaaggaatataaaaatgcgcatgcccatgtgcttggggaattgatgggt
aatggcgattctgattttaccagaacggttaaacacccagtatctccacaaaaaattatg
attgcgggcatacatgacccgctcccctatgaagcaaattttatttccgagcataaaatt
caaacttgctctccagaacaggtaaggtctggcgctcaacccgttttagactggatcaag
aatgaaaaaatcgaatatctggccatccatatagacttggatgtattggatccccataat
ttcagatctgttctttttgctaaaccgggtcgaggacagcatgatttcggggatgtcgca
gaaggcaaattaaacataccagatgtcgtaaaattggctaatcaagcggcctctatttcc
aaggcggtgggtttaactattgccgaacatctcccatgggatgcgcttaatttaaagaat
atgctcgaagaactgcctttaatcgggaaataa

DBGET integrated database retrieval system