KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0994Help
Entry
Zmob_0994         CDS       T01875                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00010  Glycolysis / Gluconeogenesis
zmm00051  Fructose and mannose metabolism
zmm00562  Inositol phosphate metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01120  Microbial metabolism in diverse environments
zmm01130  Biosynthesis of antibiotics
zmm01200  Carbon metabolism
zmm01230  Biosynthesis of amino acids
Module
zmm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zmob_0994
   00051 Fructose and mannose metabolism
    Zmob_0994
   00562 Inositol phosphate metabolism
    Zmob_0994
Enzymes [BR:zmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Zmob_0994
Exosome [BR:zmm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Zmob_0994
  Exosomal proteins of bladder cancer cells
   Zmob_0994
  Exosomal proteins of melanoma cells
   Zmob_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH62829
UniProt: A0A0H3G2A3
Position
complement(1162007..1162756)
Genome map
AA seq 249 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgttgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaagtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgggcaaaaacgacaacggcgatagccaatggccttgtg
acgattgtctgtattggcgagtcccgtgctgcccacgcatcgggtcaggctttgcctatt
atcggggcgcagctggatggctgtattccgcccgatgccaccagcgataatctagttgtt
gcctatgaacccatctgggctatcggaacgggtaataccccaccgcctgaaagcattgcc
gaaatgcatgcctcgattcgtgaccgcttgtgcttgttattgggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaactcttgtcggtggcgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttggcctag

DBGET integrated database retrieval system