KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1109Help
Entry
Zmob_1109         CDS       T01875                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00260  Glycine, serine and threonine metabolism
zmm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01130  Biosynthesis of antibiotics
zmm01230  Biosynthesis of amino acids
Module
zmm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zmob_1109
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zmob_1109
Enzymes [BR:zmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Zmob_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF2092
Motif
Other DBs
NCBI-ProteinID: AEH62941
UniProt: A0A0H3G732
Position
complement(1288332..1289156)
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKE
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKAVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacggcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgtcgatattatcgaattagggatgcccttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacgacatccggaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagcttcgccgcctctgcaaaagaa
gccggtgttgacggcattatctgtgtcgatattccgccagaagaagacgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggctcgccaccccgaccagtgatgaa
gcgcgtttgaaaatcatcctcgatggggcttccggtttcctctattatgtttctgtcgcg
ggcgttacgggtctgcaacaggcaactgaagccagcattgatgccgcgcttgatcggatt
aaagctgtaacagatttgccggttgccgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtgggttcggcctttgtgtcttgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgccgccttagaaaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system