KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1736Help
Entry
Zmob_1736         CDS       T01875                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00860  Porphyrin and chlorophyll metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Zmob_1736
Enzymes [BR:zmm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Zmob_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF4291 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AEH63547
UniProt: A0A0H3G8Q9
Position
complement(2016764..2018125)
Genome map
AA seq 453 aa AA seqDB search
MTIQPPTILKQNFIDRYAGRNVPRYTSYPTAADFRNDLTPKEHAIRIKNIAPDSRISVYL
HVPFCQQLCHYCGCHTKVVRRQEIITAYVDTLVKEIETVGNLAPNHLKIGHLSWGGGTPS
IIGIEGIRRVMKALQRYFDAAEDMIHAMELDPRLLDAEFAQNLFDIGINRTSLGVQDFNP
HIQKAIGRVQPIEQVEKAILALRQAGISQVNFDLLYGLPHQGLDEIRLNCQETLRLSPDR
IACFGYAHLPERKANQKLIDESALPQTKERFEQAALIAEILQQNGYQAIGIDHFAKTDDL
LAVAAWEKKLRRNFQGYTTDNEPVLIGLGASAISTFSDAYIQNIADIKNYSRAIEEQGLA
SFRGIDISQEDHLRGEIISALMCHFAVDLTPYDKSLSLEDEKRELSHLEEEGLIQFQQNR
IEMTDAGRPFVRIVAAVFDSYRKQKKQGFSRAI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccagccgcctacaattttaaaacaaaattttattgaccgttatgccggacgt
aatgtgcctcgctatacttcctatccgacggcggctgattttcgtaatgacctgacgccc
aaagagcatgcgatccgaatcaaaaatattgcgccggatagtcgaatatcggtttacctt
catgtccccttttgtcagcagctttgccattattgtggttgtcacaccaaggttgtccgc
cgtcaggaaatcattacagcctatgttgatactctggttaaagagatagagactgtcggt
aatctggcacctaatcatctaaaaataggtcatctctcttggggtggtggaaccccgtcc
atcatcggaattgaaggtatccgtagggtaatgaaggccttgcaacgctattttgatgcg
gctgaggatatgatccatgcgatggaacttgacccgcgtttactggatgccgaattcgct
caaaatctttttgatattggcatcaatcgcaccagtcttggggttcaagactttaacccg
catattcaaaaagcgatcggccgcgttcaacccatcgagcaggttgaaaaagctattctg
gccttgcgacaagcgggcatcagtcaggttaattttgaccttctctatggcctgccccat
caagggttggatgagatacgtcttaattgtcaagaaacgctgcgcctgtcgcctgacaga
attgcctgttttggctatgcccatttgccagaaaggaaagccaatcagaaattgattgat
gaaagcgccctgccccaaaccaaagagcgttttgagcaggcggctttgattgccgaaata
ttgcaacaaaatggatatcaagcaatcggtattgatcatttcgctaaaaccgatgattta
ttggccgtagctgcatgggaaaagaagctacgccgcaactttcaaggttataccaccgat
aacgagccggtattgatcggtttaggggcatcggccatctcgactttttcagatgcctat
atccagaatatcgccgatattaaaaattatagccgagctattgaagaacagggtttagcg
tcttttagaggtatcgatatatcgcaagaagatcatcttagaggtgaaatcattagcgcc
cttatgtgtcattttgcggttgatttaacgccttatgataaaagcctatctcttgaagat
gagaaaagagaactgagtcatctggaagaagaaggattgatccagtttcagcagaaccga
atagagatgactgatgcaggacgcccctttgttcgtatcgtcgcggcggtgttcgacagt
tatcgtaagcagaaaaaacaaggctttagccgcgctatctaa

DBGET integrated database retrieval system