KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0176Help
Entry
Za10_0176         CDS       T01110                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00900  Terpenoid backbone biosynthesis
zmn01100  Metabolic pathways
zmn01110  Biosynthesis of secondary metabolites
zmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Za10_0176
Enzymes [BR:zmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Za10_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Sacchrp_dh_NADP DUF4213 Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: ACV74730
Structure
PDB: 

Position
201565..202731
Genome map
AA seq 388 aa AA seqDB search
MSQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLANAAKRTNAKRAVIA
DPSLYHDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTV
ALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPF
RTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAYHLFQIPLEKFEILV
HPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAP
DYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPA
TPSSLEDVFAIDNEARIQAAALMESLPA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagccaagaacagtcactgttttaggggcgaccggatccattggtcattcaaca
ctggatttaatcgaacgaaatttagatcggtatcaggtcatcgctttgaccgccaaccgc
aatgtcaaagatctggccaatgcggcgaaaagaacgaatgccaagcgggcggttatcgct
gacccgtcgctttatcatgatctgaaagaggctttggccggaagctctgttgaggcagcc
gcgggtgctgatgccttggtcgaagccgccatgatgggtgccgattggacaatggcagcc
attatcggttgcgccggtctaaaagcgacgcttgcagctattcgcaagggcaaaacggtc
gctttagcgaataaggaatccttagtttcagctggcggattgatgatcgatgccgtgcgg
gaacatggcacgacgcttctccccgtcgattccgagcataacgctattttccaatgcttc
ccgcatcataaccgcgactatgttcgccggattattattacggccagcggaggtcccttc
agaacaacgtctcttgccgaaatggcaacggtcacgccagaacgcgcggttcagcatccc
aactggtcaatgggtgccaaaatttctatcgattctgctacaatgatgaataaagggctt
gaattgatagaagcctatcatctcttccagattccattagaaaaatttgaaattttggtt
catcctcagtcagttattcactccatggtggaatatttggatggttctatccttgcccag
atcggtagtcctgatatgagaacaccgatcggtcatactttggcttggccaaagcggatg
gaaacaccagccgaatcgttggattttaccaaattgcgccagatggattttgaggcaccg
gattatgaacgttttccggcattaactttggcaatggaatccatcaaatcaggtggggct
cgtcctgcggtaatgaatgccgctaatgaaatagctgtggcggccttccttgataagaaa
atcggttttcttgatatcgctaaaattgtcgagaaaacattagatcattatacacccgca
accccgtcttctttggaagatgtctttgcgatcgacaatgaagcgcggatacaagccgct
gctttaatggagagtttgcccgcgtga

DBGET integrated database retrieval system