KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0731Help
Entry
Za10_0731         CDS       T01110                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:zmn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Za10_0731
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:zmn03011]
    Za10_0731
Ribosome [BR:zmn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Za10_0731
  Bacteria
    Za10_0731
  Archaea
    Za10_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACV75278
Position
complement(847269..847649)
Genome map
AA seq 126 aa AA seqDB search
MSKPQAPRRVGEKEALAVATTVRGSSYKLNLVAGLIRGKKAGEALNILSFSKKAMAKDVR
KVLASAIANAENNHNLDVDALIVKEASVGKSIVMKRFATRARGRSTQIIKPFSRIRVVVR
EQEEAE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccgcaagctccccgtcgcgtcggtgaaaaggaggccttagccgtcgccacc
accgttcgcggtagctcttacaagctgaatcttgttgcgggtttaatccgtggcaaaaaa
gctggtgaagccctgaacattttgagcttttccaagaaggcaatggcaaaagatgtccgc
aaggttcttgcttctgctattgctaacgccgagaataaccacaatctcgacgttgacgct
ctgattgtgaaagaggcatcggtcggtaagtcgatcgtgatgaagcgtttcgcaacccgt
gctcgcggtcgttcgactcagatcatcaagccattttcgcgcatccgtgtcgttgtccgc
gaacaggaagaggctgaataa

DBGET integrated database retrieval system