KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0795Help
Entry
Za10_0795         CDS       T01110                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00670  One carbon pool by folate
zmn01100  Metabolic pathways
zmn01120  Microbial metabolism in diverse environments
zmn01200  Carbon metabolism
Module
zmn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:zmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Za10_0795
Enzymes [BR:zmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Za10_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ACV75342
Position
918803..920476
Genome map
AA seq 557 aa AA seqDB search
MLSDIEIARAATLKPITEIAGRLNIPDESVLSYGHTIAKLDGEYLNSLSSKPRGKLVLVS
AITPTPAGEGKTTTTVGLGDAFNRIGKKAVICLREPSLGPCFGVKGGAAGGGYAQVVPME
RINLHFTGDFHAITSAHDLLAAMIDNHVHWGNEPVMDRNSITFRRVIDMNDRMLRNMVIG
LGGKANGYPREGGFDISVASEVMAILCLASDLKDLRSRLERIIIGEDNDHNPVAAAKIKA
AGAMTALLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNSLIATKAALHLGDIAITEAG
FGADLGAEKFFDIKCRQANLEPDAVVLVATIRALKMHGGVALADLKNENIAALETGFANL
ARHAENLAKFGVKTVVAINRFHSDTETELDKLQDLCASIGLDSAVCTHFTDGGAGAEDLA
RKLSAILDAPKEDSFRLLYPDEMPLWKKIETIAKEIYRAGEVVPQGAVLKKLKSFEEQGF
GDLPVCIAKTQSSFSADPKAKNAPTGHIFPIREVRLNAGAGFIVAISGNIMTMPGLPRHP
AAENIDINEDNEIIGLA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgatatcgaaatcgctagagccgcaaccttaaaaccgattaccgagattgct
ggccgcctgaatattcctgatgaatctgttttgtcttatgggcataccatcgccaagctt
gatggggaatatctgaacagcctatcatccaaacctcgcggtaaactggttctggtaagc
gccattaccccgacccctgccggtgaaggcaaaaccacaacgacggttggcctcggtgat
gcttttaaccggatcgggaaaaaagcggttatctgtctgcgtgaaccatctttaggtcct
tgctttggcgttaaaggtggggctgccggtggtggttatgcacaggtcgttccgatggaa
cgcatcaacttgcatttcacgggtgattttcatgcaatcacttccgcgcatgaccttctg
gccgcaatgattgataatcacgtccattggggcaatgagcctgttatggatcgtaacagc
attactttccgtcgggtcattgatatgaatgaccggatgcttcggaatatggttatcggt
cttggtggaaaggccaatggctatccgcgtgaaggtggtttcgatatcagcgttgcttcg
gaagttatggctattctttgccttgcttcagatctgaaagatcttcgtagccgtctggaa
agaatcattatcggtgaagataacgatcataatccagtcgcagccgccaagattaaagcc
gctggcgcaatgacagcccttttgaaagatgctttacagccgaatcttgtgcagaccttg
gaaggtaatcctgcgcttattcatggcgggccttttgcgaatattgctcatggttgtaac
tccctgattgcaacgaaagccgcgttgcatcttggtgatattgcgattaccgaagctggc
tttggtgctgaccttggtgccgaaaaattcttcgacatcaaatgccgtcaggccaatctt
gaaccggatgcagtcgttctggtcgccacaatccgtgcattgaagatgcatggtggggtt
gccttggctgatttgaaaaacgagaatattgcagcgcttgaaaccggctttgccaatctc
gctcgtcatgctgaaaatcttgccaaattcggtgtcaaaacggtagtcgctatcaaccgc
ttccatagcgataccgaaactgaattagacaaacttcaggatctttgcgcctcgatcggt
cttgattctgctgtctgtacccatttcactgatggtggtgcgggtgccgaagatttggct
cgtaaattgtcggctatcttggatgcaccgaaggaagattctttccgccttctctatcct
gacgaaatgccgctttggaagaagatcgaaacgatcgccaaagaaatctatcgcgcaggt
gaagttgtgccgcagggtgccgttctcaagaaactgaaaagttttgaagaacagggtttt
ggtgatttgcccgtttgtattgcaaaaacgcaatcttccttctcggcagatccgaaagcc
aagaatgcgccgactggccatatcttccctattagagaagtgcgcctgaatgccggtgct
ggcttcattgtcgctatttccggtaatatcatgacgatgccgggcttaccgcgtcatcct
gccgctgaaaatatcgatatcaatgaagataacgaaattatcggcctcgcttaa

DBGET integrated database retrieval system