KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1750Help
Entry
Za10_1750         CDS       T01110                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Brite
KEGG Orthology (KO) [BR:zmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Za10_1750
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Za10_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACV76284
Position
2041940..2042731
Genome map
AA seq 263 aa AA seqDB search
MKVALGQFAVQPDWHENLDICFDLIKRAAGKEADLLVLPEGILAQDMADPDLIPKTAQPL
DGAFITRLAAETLKYPTLTIAGCLPIPDGKDRFYNTLLVIKNGQIIAQYRKLHLYDAFSY
QESRSITAGDSLPPLVEIAGFKVGLMICYDLRFPELARRLVLEGADALILPAAWVKGSGK
EAHWDILVKARALENTCYMIAVGECGQRNIGNSMVVDPLGVAIARAGEEPALIMAELFHK
RIAHARDILPVLHNRRFLPPKFI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtggcgctggggcaatttgccgttcagcctgattggcatgagaatctcgacatc
tgttttgacttgatcaaacgggcagcaggaaaagaagctgacctgcttgtgttgccagaa
ggtattctggcacaggatatggctgaccccgatcttatccccaaaacggcacaaccgctc
gatggggcttttattacgcgtttggcagcggaaactctgaaatatcccacgttgacgatt
gcaggctgcttgcccatccccgatgggaaagaccgattttataacacgctcttagtgatt
aaaaatgggcagatcattgcccaatatcggaaattgcatctgtatgatgccttttcttac
caagaatcccgctcaattaccgcgggtgatagtctgcctcctttggtcgaaattgctgga
ttcaaggttggcttgatgatctgttatgatcttcgctttcctgaattagctagacgcctt
gtgctggaaggtgccgatgcacttattctacccgcagcttgggtcaaaggttcagggaaa
gaggcgcattgggatattctggtcaaggccagagctttggaaaatacctgctatatgatt
gcggtcggggaatgtggccaacgcaatatcggaaatagcatggttgttgatccgctaggc
gttgccattgcaagggcaggggaggagcccgccctgattatggctgaactcttccataaa
cggattgctcatgcacgggacatcttgcccgtgcttcataatcgccgtttcctgcccccc
aaatttatctag

DBGET integrated database retrieval system