KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1570
Entry
ZMO1570           CDS       T00221                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00620  Pyruvate metabolism
zmo00640  Propanoate metabolism
zmo00650  Butanoate metabolism
zmo01100  Metabolic pathways
zmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ZMO1570
   00640 Propanoate metabolism
    ZMO1570
   00650 Butanoate metabolism
    ZMO1570
Enzymes [BR:zmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     ZMO1570
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 Nif11
Other DBs
NCBI-ProteinID: AAV90194
UniProt: Q5NM66
Position
complement(1599705..1602020)
AA seq 771 aa
MTISTLEKPDIAAGQASNAETQRMDSALDPWRGFKGRKWQREIDTRDFILSNVTSYTGNS
DFLAGITPKTTKLWEKLQVSLEAERKTQGGVLDVDTSTVSNITAHAPGFIEKDLEVVVGL
QTDAPLKRAIMPFGGYRMVKKGLEAYGFKEDESLSKIFPALRKTHNDGVFDVYTPEIMAC
RRSGIITGLPDAYGRGRIIGDYRRVALYGVDCLIEDKKEQGKRLERNPFDEETIKLREEV
AEQIKALHELAAMAKSYGYDISQPAVTAQQAVQWTYFAYLAAVKEANGAAMSLGRVSTFL
DIYIERDLKEGRITEAEAQELVDQFVMKLRIVRFLRTPEYDQLFSGDPTWVTESLGGMAI
DGRTLVTKSSFRFLHTLENLGPAPEPNLTVLWSENLPKGFKDYCAKISIDTSSIQYENDD
LMRSYWGDDYGIACCVSAMRIGKQMQFFGARANLAKTLLYAINGGRDEKSGVQVAPAFAP
VTGDILDYEDVKSRMVQMMEWLSSVYINALNAIHFMHDKYMYERVEMALHDLEILRTMAC
GIAGLSVAADSLSAIKHAKVKIIRDERGLATDFKIEGDYPAYGNNDDRADEIAIWLVETF
MNMLRKQTTYRRSVPTQSILTITSNVVYGKKTGNTPDGRRAGEPFAPGANPMHGRDLKGP
VASMASVAKLPYAHAQDGISNTFTIVPNALGMNKEERIDNLIGLLSGYFGAGAHHMNVNV
FDRNTLLDAVDHPEKYPQLTIRVSGYAVNFVKLTREQQMDVIHRTFHGLDN
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgaccatttccacccttgaaaaacctgacattgccgccggacaggcatcgaatgccgaa
actcaacggatggactctgcccttgatccgtggcggggttttaaggggcgtaaatggcag
cgagaaatcgacacgcgtgattttatcctgtcgaatgtcaccagctacaccggcaacagc
gattttctggccggtatcacgcccaagacaaccaaactctgggaaaaattacaagtctct
ctcgaggccgaacggaaaacccaaggcggtgttctcgatgtagatacctccacggtttcc
aatatcacggcacatgcaccgggctttattgaaaaagaccttgaggtcgtcgttggttta
cagaccgatgctccgctgaaacgggcaatcatgcctttcggcggctatcgcatggttaaa
aaaggtctggaagcctatggcttcaaagaagatgaaagcctgtcaaagatttttccggct
ttacggaaaacccataatgacggtgtctttgatgtctatacgccggaaatcatggcttgc
cgccgctccggtattatcacgggtctgccggatgcttatggtcgtggccggattatcggt
gactatcgtcgggtcgcgctttatggcgttgactgcctgattgaagataaaaaagagcag
ggcaagcgtctggaacgtaacccctttgatgaagaaaccatcaaattgcgggaagaagtt
gctgaacaaatcaaggcacttcatgaattggccgcaatggcaaaaagctatggctatgac
atttcacagcctgcggtaacggcacagcaagcggttcaatggacatattttgcatatctg
gcagctgttaaagaagccaatggtgcggcaatgtctttgggtcgggtttcgaccttcctc
gacatctatatcgaacgcgacttgaaagaaggccggattaccgaagccgaagcgcaagaa
ctggttgaccagtttgtgatgaagctccgcattgtccgcttcctccgtactcctgaatat
gaccagttattctctggtgatccgacatgggtcacggaatccttgggcggtatggctata
gatggccggactttggtcacaaaatcgagcttccgcttcttgcatactctcgaaaatctg
gggcccgcaccagaaccgaatttgacggttctttggtcagaaaatctgcctaaaggcttc
aaagattactgcgccaaaatttcgatcgatacctcgtcgatccaatatgaaaatgacgat
ctgatgcgctcttattggggcgatgattacggcattgcttgctgtgtctcggctatgcgc
atcggtaaacagatgcagttcttcggggcgcgcgccaatctagcaaaaacgctgctttat
gccatcaatggtggccgtgatgaaaaaagcggtgtgcaggttgcgcctgccttcgcgcct
gtcacgggcgatattctggattacgaagacgtcaaaagccgcatggttcagatgatggaa
tggctgtccagcgtctatatcaatgctttgaatgccattcacttcatgcatgataaatat
atgtatgaacgggtcgaaatggcgctccatgatctggaaatcttgcggacaatggcttgc
ggtatcgctggcctgtctgtcgccgcagacagcctgtccgccatcaaacatgccaaagtt
aaaatcatccgtgacgagcgtggtttagccaccgattttaagatcgaaggcgactatccg
gcttatggtaacaatgatgaccgcgccgatgaaattgcgatttggctggttgaaaccttc
atgaatatgcttcggaagcagacgacttatcgccgttctgttccgacccagtctattctg
acgatcacttccaatgtggtttacggtaaaaagaccggcaatacgcctgacggtcgtcgg
gctggtgaaccttttgcaccgggtgccaatccaatgcatggccgcgatttgaaaggcccc
gttgcctcgatggcgtcggttgccaaattgccttacgcccatgcacaggatggtatctcc
aataccttcaccattgtccccaatgctttgggtatgaacaaggaagaacggattgataat
ctgatcggcttgctttctggttatttcggggcaggggcgcatcatatgaatgtcaatgtg
tttgaccggaatactttgctggatgccgtcgatcatcctgaaaaatatccgcaattaacc
atccgtgtttctggttatgccgtcaatttcgtgaaattgacccgtgagcagcaaatggat
gttatccaccggactttccatggccttgataattaa

DBGET integrated database retrieval system