KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0027
Entry
ZMO0027           CDS       T00221                                 

Definition
(GenBank) phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00230  Purine metabolism
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Module
zmo_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ZMO0027
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO0027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO0027
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     ZMO0027
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     ZMO0027
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZMO0027
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS BING4CT
Other DBs
NCBI-ProteinID: AAV88651
UniProt: Q5NRK3
Position
29293..30897
AA seq 534 aa
MTDIAIKTALLSVSDKTGLVELGQALAAHDIKLISTGGTAKLLRDAGLAVTDISDFTGFP
EMMDGRVKTLHPKVHGGLLAVRNNPEHVAAMKAHDISAIDLVVVNLYPFRETVAKGAGRQ
EVIENIDIGGPSMVRSAAKNHDHVTIVTDPKDYPSLISELADNGGATTLDSRRRFAAKAY
AATAQYDAAISAWFAADLKEDLPELLTVPLKKASALRYGENPHQKAALYIPTLPNLPEWP
IVNGIAQAEQIQGKALSYNNYGDADAALDLISEFCDAAPTVVILKHANPCGVASGDSLIE
AYKAALACDSVSAFGGIIAVNRPLDGATAEAITSIFTEVVVAPAADEAAKAIFAKKKNLR
LLITGALPDPKRNGLNLRSIAGGILLQSRDGSLLDEQALQVVTEVKPSEQQMKDALFAWT
VAKHVKSNAIVYARDNATVGIGAGQMNRLESARIAAWKAEDAAKRAGWPESRTRGSAVAS
DAFFPFADGLVTATEAGATTVIQPGGSIRDQEVIDAANKAGIAMIFTGTRHFRH
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaccgatatagcgattaaaaccgcactgctttccgtttctgataaaacgggattggtc
gaattggggcaggctttagctgctcatgacatcaaattgatttctaccggaggcactgcc
aaattattgcgcgatgcgggtttagcggtaactgatattagcgattttaccggttttcct
gaaatgatggatggtcgggtgaaaacgctccatcccaaggttcatggtggcttgctcgcg
gtcagaaataaccctgaacatgtagcggcgatgaaggctcatgatatctcggcgattgat
ctggtggtggtcaatctttatcctttccgtgagacggttgccaaaggggcaggtcgtcag
gaagttatcgaaaatattgatattggtggcccttccatggtgcgttcggcggccaaaaat
cacgatcatgtgacgattgtgaccgacccgaaagattatccaagtttgatttctgaatta
gcggataacggtggtgccacgactttggacagccggagacgttttgcggccaaggcctat
gcggctacggcgcaatatgatgcggctatctctgcatggtttgcggctgatctgaaagaa
gatttgccagaattgctgaccgttccgctgaaaaaagcctcggctttgcgttatggtgaa
aatccgcatcagaaagcggcactttatatcccgaccttgccgaatttgccggaatggccg
attgtaaatggtattgctcaggcagaacagattcagggtaaagcgcttagctataacaat
tatggcgatgcggatgctgctttggatttgattagtgaattctgcgatgctgccccgacg
gtcgttatcctgaaacatgccaatccttgcggtgtggcgtctggtgatagtctgattgaa
gcctataaggccgccttggcttgcgatagtgtttctgcttttggaggcattattgccgtc
aatcgtccgcttgatggggctactgccgaagcgatcacctcgatctttaccgaagtcgtg
gttgcgcctgctgccgatgaggctgccaaagcgatttttgccaaaaagaaaaatctgcgc
ctattgattacgggggctttgcctgacccgaaacggaatggccttaaccttcgttcgatt
gcgggcggtattttgctccagtcgcgtgatggcagcttgctggatgaacaggccttgcag
gtggttaccgaagttaagcccagcgaacagcagatgaaagatgcgttatttgcttggaca
gtagccaagcatgtcaaatccaatgccattgtttatgcccgtgacaacgcaacggttggt
atcggtgcggggcagatgaaccgtttggaatcggcgcgtatcgctgcatggaaagccgaa
gatgccgccaagagagccggttggccggaaagccgcacccgcggttctgctgtggcttcg
gatgctttcttcccatttgctgatgggttggtaaccgcgactgaggccggagcgaccacg
gttattcagcccggtgggtctatccgtgatcaggaagtcattgatgccgccaataaggct
ggtattgcgatgatctttaccggaacccgccatttccggcattaa

DBGET integrated database retrieval system