KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0157Help
Entry
ZMO0157           CDS       T00221                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored Rossmann-like
Motif
Other DBs
NCBI-ProteinID: AAV88781
UniProt: Q5NR73
Position
complement(141693..142622)
Genome map
AA seq 309 aa AA seqDB search
MTDKPAILLRTPLFYGARDKLDSLFTVYDYGTKITPKIASQIQALIGGGQTQISADEINQ
YPNLQIIAQYAVGFDGIDLEAAKKRDIRITNTPGVLTEDVADMAVGLFLTLKRDIIRNDK
LVRDGGWIKKEEIPLSHSASNLDVGVFGLGRIGQAIAERLAPMSKSVSYCSRHPKEVSWN
YYNNILDLAKAVDVLVLAAPGTAETKGLVNKEVLEALGQKAVLINIARGSIVDEDALIEA
LEKGVIAGAGLDVFANEPNVPAALQQSQKVVLQPHLGSATVETRTTMAHLVIDNLQAFFA
GKPLLTPVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaacccgcgattctattacgcaccccgcttttttacggggcaagagacaag
ctcgactctctctttacggtttacgattacggcacaaaaataacaccgaaaatagcgtcc
caaatacaagctttaattggtggaggtcagacgcaaatcagcgctgacgaaataaaccaa
taccccaatctccagatcatcgctcaatatgccgttggctttgacggcatcgatcttgaa
gctgctaaaaaacgagatatcagaataacaaacactccgggtgttttgaccgaagatgtc
gctgatatggctgtcgggttattccttaccttaaaaagggacatcatccgaaatgacaag
ctggttcgtgacggcggctggattaaaaaagaagaaatcccgttgtcccacagcgccagc
aatcttgatgtcggggtctttggtttaggacgaattggccaagccatcgccgaaagactg
gcacccatgtccaaatctgtcagctattgcagccgtcatcccaaggaagtctcttggaat
tattacaacaatatccttgatctggcgaaagccgttgacgtgctggttttggcagcccca
ggcacagccgagaccaaaggccttgtcaataaagaggttctggaagccttgggtcaaaaa
gctgttcttatcaatattgcccgtggcagcattgttgatgaagatgccttgatagaggcg
cttgaaaaaggcgtcatcgcaggtgctggattggatgtttttgctaatgaacccaatgtg
ccagcggccttacagcaatctcagaaagtcgttttacagccccatttaggcagcgccact
gtcgagacacggacaacaatggcgcatttggtgatcgacaatcttcaggccttttttgct
ggaaaaccgcttcttacgccggtgatctga

DBGET integrated database retrieval system