KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0215
Entry
ZMO0215           CDS       T00221                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO0215
Enzymes [BR:zmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     ZMO0215
SSDB
Motif
Pfam: 5-FTHF_cyc-lig
Other DBs
NCBI-ProteinID: AAV88839
UniProt: Q5NR15
Position
208262..208912
AA seq 216 aa
MSVASSSLFSVSDLLKEGDTSDNIQPTASLADKKSLRKLFRQRRKALADHPSWKADGLIF
TLMLAEHIRSHFGKARSISAYLPNDGEVDPLPIFLQAIDAGITPLLPRIVEKDAPLDFHR
WWPGDPLEEKNGGILQPVAESEKIVPDIILTPLVGFDRSLRRLGRGGGYYDRSFKAYPDA
IRIGVAWSIQEAEAIPVEAWDMPLHAVATEKEWIGF
NT seq 651 nt   +upstreamnt  +downstreamnt
gtgtccgttgcgtcgtcttcccttttctctgtttctgatcttctgaaagaaggggataca
tcggataatattcagccaacagcgtcattggctgataaaaaatccctgcggaaattattt
cgtcagcgtcggaaggctttggctgatcatccttcttggaaagctgatggcttgattttt
acgctgatgttggctgaacacatccgtagtcatttcggaaaagcacgttctatttcggct
tatttgcccaatgatggtgaagtcgatcctttgcctattttcttgcaggcgattgatgcc
ggtatcacgcctttattgccgagaattgttgaaaaagacgcacctctggattttcatcgc
tggtggccgggtgaccctttggaagagaaaaatggcggtattttgcagccggttgcagaa
tctgaaaaaatagtgccggatattattttaacgcccctagtcggttttgatcgctctttg
cgccgtttgggacgaggcgggggatattatgaccgcagtttcaaggcctatcccgatgcc
attcggatcggcgtagcttggagtattcaagaggcagaggctattccggttgaagcttgg
gatatgccccttcatgcggttgcgaccgaaaaagaatggataggtttttag

DBGET integrated database retrieval system