KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0584Help
Entry
ZMO0584           CDS       T00221                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00260  Glycine, serine and threonine metabolism
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01130  Biosynthesis of antibiotics
zmo01230  Biosynthesis of amino acids
Module
zmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO0584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0584
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZMO0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF2092
Motif
Other DBs
NCBI-ProteinID: AAV89208
UniProt: Q5NPZ7
Position
complement(585239..586063)
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKE
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKAVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacggcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgtcgatattatcgaattagggatgcctttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacggcatccagaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagcttcgccgcctctgcaaaagaa
gccggtgttgacggcattatctgtgtcgatattccgccagaagaagacgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggctcgccaccccgaccagcgatgaa
gcgcgtttaaaaatcatcctcgatggggcttccggtttcctctattatgtttctgtcgcg
ggcgttacgggtctgcaacaggcaactgaagccagcattgatgccgcgcttgatcggatt
aaagctgtaacagatttgccggttgctgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtgggttcggcctttgtgtcttgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgcagccttagagaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system