KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0708
Entry
ZMO0708           CDS       T00221                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00230  Purine metabolism
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Module
zmo_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ZMO0708
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO0708
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     ZMO0708
SSDB
Motif
Pfam: Formyl_trans_N
Other DBs
NCBI-ProteinID: AAV89332
UniProt: Q5NPM8
Position
complement(703477..704103)
AA seq 208 aa
MANSPAKKKVGVLISGRGSNMEALIEASNRPDCPYEITLVFSNIEDAQGLKTAEEAGIKT
AFLDHRGHGGRAAYDQKVLAILQEAKLDIVVLAGYMRIVTPEFVSAWEGRMLNIHPALLP
SFTGLDTHKRALESGVRWHGCTVHFVTSKLDAGPIITQAAVPVYEDDTEDSLAKRVLKEE
HRIYAEALEDLAADRLILKDNRVFHKKG
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctaatagcccagcaaagaagaaggtcggtgttttaatctccggccgtggatcgaat
atggaagccttgatcgaggcttccaaccgccccgattgcccttatgaaatcaccttggtc
ttctccaatattgaagatgcccaaggcctcaaaaccgccgaagaagctggtatcaaaacg
gcttttcttgatcatcgcggccatggcggacgggcagcttatgatcaaaaagtgctggct
atcttacaggaagccaaactcgatatcgtggttctcgccggttatatgcggattgtaacg
ccggaatttgtctcagcatgggaaggccggatgctcaacatccaccccgcccttttaccg
agctttaccggacttgatacccataaacgcgcgctagaatctggggtcagatggcatggc
tgcaccgtgcattttgtcacttccaaactagatgctgggcccatcatcacacaggcggcc
gttccggtctacgaagacgacaccgaagatagcttggcaaaacgggtgttgaaagaagaa
caccgcatctacgccgaggcgctagaagatcttgccgccgatcgtcttattctcaaagat
aaccgcgtttttcataagaaaggataa

DBGET integrated database retrieval system