KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0811
Entry
ZMO0811           CDS       T00221                                 

Definition
(GenBank) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00670  One carbon pool by folate
zmo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO0811
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ZMO0811
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     ZMO0811
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: AAV89435
UniProt: Q5NPC5
Position
complement(813279..814184)
AA seq 301 aa
MKIIFMGTPDFALPTLNALVDAGHEIVAVYSQPARPAGRGKAPRPSPVEKRARELGLNVY
TPVSLKEAETQKIFADHQADVAVVAAYGLLLPKAILEMPRLGCLNVHGSLLPKWRGAAPV
QRAILAGDQESGVTIMQMDRGLDTGAMLKIEKTPIADKNAGALSDEIAHIGAKLMVEVLA
QPEQYPPVKQPESGESYAAKIDKSEALIDFSKGAVQAERQIRAFAPKPGAFFLYNEERIR
ILEAHVQNQAGAVGETLDDHLLIGCGSDSLQPVIVQRAGRKAMKLEDMLRGFAIPRGTRL
S
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaaaattatttttatgggaacccccgatttcgccctaccgacattaaacgccttggtt
gatgccggacatgagatagtggctgtctattcccagcccgccagacctgccggacgcggc
aaagcaccccgcccttctccggttgaaaaacgggcaagggaattgggcttaaatgtctat
acgcctgtttctctgaaagaagccgaaacacagaaaatatttgctgatcaccaagccgat
gttgcggttgtcgcggcctatggcctgttattacccaaggccattcttgaaatgccgcgc
cttggttgtttaaatgtgcatggctctcttctcccgaaatggcgtggcgcagcccctgtc
caacgggcgatccttgctggcgatcaagaaagcggcgtaaccatcatgcagatggatcgc
ggccttgataccggagcaatgctcaaaatagaaaaaacgccgatagcggataaaaatgca
ggcgctctttcggacgaaattgctcatatcggggcaaaattgatggtcgaagtgctggca
cagccggaacaatatccgcccgtcaaacaaccggaaagcggcgaaagctatgccgctaaa
attgacaaaagtgaagccttaatcgacttttccaaaggtgccgtgcaggctgaacggcaa
attcgcgcttttgcccccaaacctggggcattcttcctttataacgaggaaagaatacgc
atcttggaagcccatgtccaaaatcaggccggtgctgttggtgaaacgctcgatgatcat
ctgttaatcggctgcggcagcgattctctccaaccggtcattgtccagcgcgccggacga
aaagccatgaaactggaagatatgctgcgcggtttcgccattccacggggaacgcgtctt
tcatga

DBGET integrated database retrieval system