KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1201
Entry
ZMO1201           CDS       T00221                                 

Definition
(GenBank) Glycine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00260  Glycine, serine and threonine metabolism
zmo00460  Cyanoamino acid metabolism
zmo00630  Glyoxylate and dicarboxylate metabolism
zmo00670  One carbon pool by folate
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
zmo01240  Biosynthesis of cofactors
Module
zmo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ZMO1201
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO1201
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO1201
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ZMO1201
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO1201
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     ZMO1201
SSDB
Motif
Pfam: SHMT Aminotran_1_2 DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: AAV89825
UniProt: Q5NN85
Position
1225183..1226472
AA seq 429 aa
MTKETASFFTDRLAAADPDVLTAINHELNRQRKQIELIASENIVSRAVLEAQGSVFTNKY
AEGYPGKRYYQGCAPSDEIETLAIERAKKLFGSEFVNVQPHSGAQANGAVLLAVAKPGDT
IMGLSLDAGGHLTHGAKAAMSGKWFNAVQYAVHPETQLIDYDQVRDLALKNKPRVIIAGG
SAYPRHIDFAFFRKVADEVGATFMVDMAHFAGLVAGGVHPSPVPHAHITTTTTHKTLRGP
RGGMILTDDPALAKKINSAVFPGMQGGPLMHVIAAKAVAFGEALQPSFKEYAKAVVENAQ
ALAARLKERGSDLVTGGTDTHLALVDLRPLGVTGRDADCALERAGITCNKNGIPFDPLPP
VKTSGIRLGSPAATTRGFRKAEFLQVADMIADVLDALSSKGEQGDPAVETAVRQRVEALC
DRFPLYPEL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgactaaagaaacggcatctttctttaccgatcgcttggctgcggctgatccagatgtg
ttgacagcgatcaatcatgaattgaaccgccagcgcaagcagatcgagcttatcgcttct
gaaaatattgtcagccgtgctgttctggaagcgcaaggctctgtctttaccaataaatat
gctgaaggctatcccggcaagcgctattatcagggttgcgccccttccgatgagatcgaa
acgctggctatcgaacgcgccaagaaattattcggcagcgaattcgtcaatgttcagcca
cattccggcgctcaggcaaatggtgccgttcttttagcggtcgcgaagcccggcgatacc
attatgggtctgtctttggatgccggtgggcatttgacccatggtgccaaggcggccatg
tctggcaaatggttcaatgcagttcagtatgcggtgcatcctgaaacccagttgatcgat
tacgatcaggtgcgcgatctggctttgaaaaacaagccgcgcgttatcattgcgggtggc
tcagcctatccccgtcatatcgattttgccttcttccgtaaggttgccgatgaagtcgga
gctacctttatggttgacatggcgcattttgcaggtctggttgctggcggtgttcatcct
tcacctgtgccacatgcgcatatcacgaccacgacaacgcataagaccttgcggggcccg
cgcggtggtatgatcttgaccgatgatccggctttggcaaagaaaatcaattcggctgtc
ttccctggcatgcagggtggccccttgatgcatgtcatcgcggcaaaagcagttgctttc
ggtgaggccttgcagccttctttcaaagaatatgcaaaagctgttgtcgaaaatgctcaa
gccttggcagctcgcttgaaagaacgcggtagcgatctcgtaacgggtggcacggatacg
catctggctttggttgatcttcggcctttgggtgtgactggccgtgatgctgattgtgct
ttggaacgcgccggtatcacctgcaacaaaaatggtattcctttcgatccgttaccgcca
gttaaaacctccggtatccgtctgggatcgcctgcggcgacgacccgcggtttccgtaaa
gcggaattccttcaggtcgctgatatgattgctgatgttcttgatgcgttgagcagcaag
ggcgaacaaggtgatccggcggttgaaaccgctgttcgtcagcgtgtcgaagcgctctgt
gatcgcttcccactttatccggaattgtaa

DBGET integrated database retrieval system