KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1347Help
Entry
ZMO1347           CDS       T00221                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00260  Glycine, serine and threonine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01130  Biosynthesis of antibiotics
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO1347
Enzymes [BR:zmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ZMO1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Na_sulph_symp
Motif
Other DBs
NCBI-ProteinID: AAV89971
UniProt: H2VFP6
Position
complement(1361572..1362585)
Genome map
AA seq 337 aa AA seqDB search
MQSIRFFSDNAATVAAPVMDAIIAANQSDMAYDSDKWSQKLDAIFSELFGTDVTAHWAVT
GTAANALSLSAICPPFGGVLCSQDAHVQTDEGGAPEFYTGGSKLLLVPGEGAKITPEALK
TRAEAIADSVHMVQPHAVTITNSTELGQVYTPEETAAIGAVAREKGLRFHLDGARFANAV
AALGCNPADLTWKAGVDLMSFGFTKNGAMAAEAIVFFDRELAAHNKRRRKRAGHLLSKGR
FIAAQIEAMLKNDLWLDLARSSNTVAKRIAEAVDPKRHAYPVKANEVFLFISMEERAELR
KQGFVFYDWGHDKIRLVASWDQPEHEVVALEKALKAL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtattcgtttcttttccgataacgctgccactgtcgcagcccccgtcatggat
gctattatcgccgccaatcaaagcgacatggcttatgattccgataaatggagtcagaaa
cttgacgctattttctcggaattattcgggacagacgtaacggctcattgggcagtcacc
ggaacggcggccaatgccctgtctttatccgctatctgcccgccttttgggggtgtttta
tgcagtcaggatgcccatgtccaaacggatgaggggggcgctcctgaattttacaccggc
ggttccaaattgctgttggttccgggcgaaggcgctaaaattacgcccgaagccttaaag
acaagagccgaagcgattgctgacagcgtccatatggtgcaacctcatgcggtgaccatt
accaattcaactgaattaggtcaggtttacacgccagaagaaacagcggctattggtgcc
gttgcccgtgaaaaaggcttgcgtttccatctggatggcgcccgttttgctaatgcggtt
gctgctctcggctgcaatccggctgatctgacatggaaagccggtgttgatttgatgagc
ttcggctttaccaaaaatggtgccatggccgcagaagcgatcgttttcttcgatcgtgag
cttgctgcccacaataaacgtcgccggaaacgggccggtcatttgctgtccaaaggtcgc
ttcattgccgcccaaatcgaagccatgttgaaaaatgatttatggcttgatctggcgcgt
tcttccaataccgttgccaaacggattgcagaagccgttgatcccaaaagacatgcctat
ccggtcaaagccaatgaagtcttcttattcatctcgatggaagaacgggcagaattgcgg
aaacagggctttgttttctatgactggggtcatgacaaaatccgtctggttgcctcatgg
gatcagccagaacatgaagtcgttgcattagaaaaagccttaaaggctttataa

DBGET integrated database retrieval system