KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1632Help
Entry
ZMO1632           CDS       T00221                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00300  Lysine biosynthesis
zmo01100  Metabolic pathways
zmo01120  Microbial metabolism in diverse environments
zmo01230  Biosynthesis of amino acids
Module
zmo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ZMO1632
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ZMO1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AAV90256
UniProt: Q5NM04
Position
1674813..1675943
Genome map
AA seq 376 aa AA seqDB search
MTIAPDPVDLAARLIACKSVTPSDDGAMNIMADALKSAGFTVHLLTKGQAPDGPVTNLIA
IRGEGYPHLAYAGHSDVVPAGQGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRY
TEHKGTLSLLITGDEEGPATFGTPAIIEWLNEQSIKPDYCLVGEPTSVERLGDTVKNGRR
GSVNMWIEVEGIQGHVAYPDRACNPIPVLARIISDLESWVLDKGDQWFQPSNLEVTSIEC
DNKATNVIPALAKAQLNIRFNALHKGAELVDSLKKRVAAIDPKARVKAAISGEAFVTEEG
VLTDTISAAIAKNTGITPSLSTSGGTSDARFLTKLCPVVEFGLVNATMHKVDEKASVEDI
RQLSRIDEDIIKSFLG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagcgcctgatcctgttgaccttgccgcccgactgattgcctgtaaatcggta
acgccatctgatgatggtgccatgaatattatggcagatgctttaaaatcggctggtttt
actgttcatctgttgaccaagggacaggcacccgatggacctgtaacaaaccttattgct
attcggggcgaaggctatccccatcttgcctatgccggtcatagcgatgtcgtgccagca
ggtcagggttggagttcagatccgttcaccccaacgattaaagacggctatcttgtcggg
cgtggtgcggttgatatgaaaagttcagtagcagccttcatcgcggcagcctctcgctat
actgaacataaaggcactctctctttgctgattacaggggatgaagaaggccctgcgacc
tttggaacgcctgccatcatcgaatggttaaatgaacagtctatcaagccagattactgt
cttgtcggtgaaccgacatcggtcgagcgtttgggcgatactgttaaaaacggacggcgt
ggctcggttaatatgtggattgaagtagaaggcatccaaggccatgtggcttatcctgac
cgcgcctgcaatcctattccggttttggccagaattatttctgatctcgaaagctgggtc
ttagataaaggcgatcagtggttccagccctctaatctcgaagtgacttcgattgaatgt
gataacaaggctaccaatgttattccggctttagccaaagcgcagcttaatattcgtttt
aatgccctgcataagggcgctgaattagtggatagcctgaaaaagcgggtagcagcgatt
gaccccaaagccagagtgaaagcggctatttctggggaagcctttgtcacggaagaaggg
gttctgacagatacaatatcggcggctattgccaaaaataccggtattacgcccagcctt
tcaaccagtggtggcacgtcagatgcgcgtttcctgaccaaattatgtccggtagtcgaa
ttcggtcttgtcaatgccacgatgcataaagtcgatgaaaaagcctcggtcgaggatatc
cggcagttaagccggattgatgaagatattatcaaatctttcttgggataa

DBGET integrated database retrieval system