KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1745
Entry
ZMO1745           CDS       T00221                                 

Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00270  Cysteine and methionine metabolism
zmo00450  Selenocompound metabolism
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ZMO1745
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ZMO1745
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO1745
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     ZMO1745
SSDB
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding
Other DBs
NCBI-ProteinID: AAV90369
UniProt: Q5NLP1
Position
complement(1786258..1788870)
AA seq 870 aa
MTELSTDNNKAARFFNIGERTNVTGSARFKKLILSGDYATAVEVARQQVENGAQIIDVNM
DEGLLDAKEAMVTFLRLLMAEPDIARLPIMVDSSRWEVIEAGLQCVSGKPIINSISMKEG
EEPFLAHARVAMVYGAAVVVMAFDEKGQADSRDRKIEICKRAYDLLTGIGFPAEDIIFDP
NIFAVATGIDEHRRYAIDFIEACREIRRICPHTHISGGVSNLSFSFRGNEPVRRAMHSVF
LYHTVQAGMDMGIVNAGQLDVYDVIDPVLREACEDVIWDRREDATERLITLAENYRQDGS
QPDKKTEEWRSYEVRKRLEYALVKGIDSHIIEDTEEARLVSDRPIEVIEGPLMDGMNVVG
DLFGSGKMFLPQVVKSARVMKKAVAYLLPYIEAAKDKNARAKGRIIMATVKGDVHDIGKN
IVGVVLQCNGYEVIDLGVMVPWEKIIEAIKEHDADIVGLSGLITPSLDEMVTAATEMERA
GIKIPLMIGGATTSKAHTALRIDPVYSGCVIHVLDASRSVGVASALLSDTQHDQFVKDTA
EAYQKIREARSGNKQSKLLPIEQVRKNAFVIDPALKPAAPKQLGIHLFKEWDLAELRAYI
DWTPFFRAWELAGNFPAILEDEIVGETATSLYQDAQAMLDQLIEEKWLTAQAIVGLWPCR
RRGDDILVNDNGKEICLPMLRQQMEKRADRANMCLADFITEEDDWIGGFALTTGHGIESH
LARFRAENDDYHDILLKALADRFAEALAERLHQYVRTTLWGYAEEENCDNLALIQEKYKG
IRPAPGYPACPDHSLKTILFDMLDVTRSINVTLTDSLAMWPTAAVSGFYFGHPQSSYFGV
ARIGEDQLEDYAVRRGVELDIARRWLTPNL
NT seq 2613 nt   +upstreamnt  +downstreamnt
gtgacagagctttccactgacaacaataaagccgctcgttttttcaatattggtgaacgc
accaatgtgaccggttctgcccgttttaaaaagctgattttatcaggggattatgcgacc
gctgtcgaagtggcgcggcagcaggttgaaaatggcgcgcagattattgacgtcaatatg
gacgaaggtctgttagatgccaaagaggcgatggttactttccttcggctgttaatggct
gaaccggatattgcccgtttgccgatcatggtcgacagttcccgttgggaagtcatcgaa
gctggtctgcaatgcgtttccggcaaacccatcatcaattcaatcagcatgaaagaaggg
gaagaaccctttttagcccatgcccgtgtggcaatggtctatggtgcggctgttgtggtg
atggcctttgatgaaaaagggcaggccgatagccgcgatcgcaaaattgaaatctgcaaa
agagcctatgaccttttaacaggtatcggttttccggctgaagatattatcttcgatccc
aatatttttgctgttgctaccggtattgatgaacatcgccgctatgcgatcgattttatc
gaagcctgtcgcgaaattcggcgaatttgtcctcatacccatatttcgggcggggtttcc
aacctgtccttctccttccgaggcaatgagccggttcgtcgagccatgcacagcgttttt
ctctatcatacggtgcaggccggtatggatatggggattgtgaatgccggacagcttgat
gtctatgacgtgattgatccggtccttcgcgaggcctgcgaagatgtcatctgggatcgc
cgcgaagatgccaccgaaagactgattacccttgccgaaaattatcggcaggatggcagc
caaccggataagaaaacagaagaatggcgcagttatgaagtccgcaagcggctcgaatat
gcattggttaaaggcattgattcccatatcattgaagatacggaagaagcgcgtttagtc
agtgaccgtccaattgaggtcatcgaagggcctttgatggatggcatgaatgtcgttggt
gatctgttcggtagcgggaaaatgttcctgccacaggtcgtaaaatctgcccgcgtcatg
aaaaaagcggtggcctatttgttgccttatatcgaggcggccaaagataaaaatgcccgt
gccaaagggcgcattatcatggcgaccgttaaaggcgatgttcatgatatcggtaaaaat
attgtcggtgttgtgctgcaatgtaacggttacgaagtgattgaccttggcgttatggtg
ccttgggaaaaaattattgaagccattaaagaacatgatgccgatattgtcggcctttcc
ggtttgattacgccttccttggatgaaatggtaacggctgctaccgagatggagcgcgcc
ggaataaaaattcctctgatgattggtggagcaacgacgtccaaggcgcatacggcatta
cggattgatccggtttattcgggatgtgttattcatgtgctggatgcgtcccgttcggtc
ggggtcgcttctgccttgttatcggatacccagcatgatcaattcgtgaaggatacggcc
gaggcctatcaaaaaattcgtgaggccagaagcggtaacaagcaatcgaaattattgcca
atcgaacaagtgcgcaaaaatgcttttgttattgatccggccttaaaaccggcggcaccg
aaacagctgggcatccatctgtttaaagaatgggatttagccgaattacgcgcctatatt
gattggacgcccttctttcgggcatgggaattggctggtaattttcctgctattttggaa
gatgaaattgtcggagagacagctacttctctctatcaggatgcgcaggccatgctcgat
caactgatcgaagaaaaatggctaacggcacaggccattgtcggattatggccatgtcgc
cgccgtggtgatgatatcttggtcaatgataatggcaaagaaatctgccttccgatgttg
cggcaacaaatggaaaaacgtgccgatcgggcgaatatgtgccttgctgattttattacg
gaagaagatgactggatcggcggttttgctttgaccactggccacggtattgaaagtcat
ctggcgcgtttccgtgctgaaaatgacgattatcacgatattttattaaaggctttggcg
gatcgctttgctgaggccttggctgaaaggctccatcaatatgtcagaacgacgctttgg
gggtatgccgaggaagaaaattgcgacaatctcgccctgatacaggaaaaatataaaggt
atccggcctgcgcccggttatccggcctgtcccgatcacagtttaaaaacgatccttttt
gatatgctggatgtgacgcggtctatcaatgtcactttgacggacagcttggctatgtgg
ccaacggcggctgtttcgggattctatttcggacatccgcaatccagctatttcggcgtt
gcccgtatcggtgaagatcaattggaagattatgcggttcgtcgtggtgttgaactcgat
atagcgagaaggtggttgacaccgaacttataa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1746
Entry
ZMO1746           CDS       T00221                                 

Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00270  Cysteine and methionine metabolism
zmo00450  Selenocompound metabolism
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ZMO1746
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ZMO1746
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO1746
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     ZMO1746
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-ProteinID: AAV90370
UniProt: Q5NLP0
Position
complement(1788920..1789975)
AA seq 351 aa
MKKSIAAERLREEASKRILLTDGAFGTMIQRYNLDEAAYRGKYELGHDQKGNNDLLVLTR
PDVIDAITRAYLDAGSDMVSTNSFNANKISQSDYNAESLVTDMNRQAAAIARKAADEYQA
KDGRPRFVAGAVGPTNKTLSLSPDVNDPGYRAIDFDHLKEVYAHQVSGLIEGGADFILIE
TIFDTLNAKAGIMAVLEESQRLQREIPMMISMTITDMSGRNLSGHSIEAFWYAVRHAKPL
TIGLNCSFGADKLRSHVKTLSALADTLLMAYPNAGLPNDLGQYDEMPETTGHFIEEWAQS
GMVNIVGGCCGSTPEHIAAMAKAVKGYPPRKSAKMAPAMRLAGLDPMIVPA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaaaaagagcatagcagcagaacgtcttcgggaagaagcaagcaagcgtatcttgctg
acagatggtgcttttggcacaatgattcagcgctataatctggatgaggccgcctatcgg
ggcaagtatgagctgggtcacgatcaaaaagggaataatgaccttttggtattgacccgt
cccgatgttattgatgccattacccgcgcttatctggatgcgggttctgatatggtttcg
accaatagtttcaacgccaacaagatcagccagtcggattataatgccgaatctctggtc
actgatatgaaccgccaagcagcagcgattgccagaaaggccgctgatgaatatcaggca
aaagatggtcgcccccgctttgttgccggcgcggttggccccaccaataaaacgctttca
ttatcgccggatgtcaatgatccaggctatcgtgcgattgatttcgatcacctgaaagag
gtctatgcccatcaagtatccggtcttatcgaaggcggtgccgattttatccttattgag
actatttttgatacgctgaatgccaaggctggtattatggccgtacttgaggaaagtcag
cggttacagcgcgaaatcccgatgatgatttcgatgactatcaccgatatgtcaggacgc
aatctttcgggtcattctatcgaagccttttggtatgcagtgcgccatgccaagccattg
acgattggcctcaactgttctttcggggcagataaattgcggtcgcatgtcaaaacgctt
tccgctttggccgatactttgttgatggcttatccgaatgcaggattgcccaatgatttg
gggcaatatgacgaaatgcccgaaaccacggggcattttatcgaagaatgggcgcaatcc
ggtatggttaatattgtgggcggttgttgtggttcaacgcctgaacatattgctgccatg
gccaaggccgtgaagggctatccccccagaaaatcggccaaaatggcaccggcgatgcgt
cttgccggactcgacccgatgattgttccggcctga

DBGET integrated database retrieval system