KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1747
Entry
ZMO1747           CDS       T00221                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO1747
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ZMO1747
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: AAV90371
UniProt: Q5NLN9
Position
complement(1790044..1790949)
AA seq 301 aa
MERILRENPNFVAEPFLGEKEPHISFEFFPPKNEEADKLLWQSVERLAPLKPRFMSVTYG
AGGSTRERTRATVTRIARETTIPAVAHLTCVNASRDEIDDIARDYWDAGIRHIVALRGDP
PGGERFQARPDGYANAVELVEGLKRIAPFEISVACYPETHPQALSPEADIEFLKRKFDAG
ATRAISQFFLSADVFLRFRDRVAAAGITAEILPGIMPTSNISGLRRMADSCGIAIPEKLG
RLMESLDKDDPSVKQMVSMAVTSDLCSQLAREGVDSFHFYTMNRAEITSALCRLLGRQPV
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaacggatacttagagaaaatccgaattttgtcgcagaaccgtttctgggcgagaaa
gaacctcatatctcttttgagttcttcccgcccaaaaatgaagaagccgacaagctgttg
tggcaatctgttgaacgtttggcaccgttgaaaccgcgcttcatgtctgtaacctatggg
gcaggcggctctacccgtgaaaggacacgggcaacggtgactcgaatcgcacgggaaacg
acgattccagcggtagcgcatttgacttgtgttaatgccagccgtgatgaaattgacgat
atcgcccgagattattgggatgcaggtatccgtcatattgtcgcattacggggcgatccc
cccgggggggagcgttttcaggcacgccctgatggttatgccaatgcggttgaattggtc
gaaggcctgaaacggatagcgccttttgaaatttcggttgcctgttatcccgaaacccat
ccgcaagcattaagcccagaagctgatatcgagtttttgaaacggaaattcgatgccgga
gcgaccagagcgatcagtcagtttttcctttcggcagatgttttcttgcgcttccgtgat
cgggtcgccgccgctggtattacggctgaaattttacccggtattatgccgacttccaat
attagcgggttaaggcggatggccgatagctgtggtattgcgatacccgaaaaacttggc
cgtttgatggaaagccttgataaagatgatccgtctgtcaaacagatggtgtctatggcg
gtaacctccgatttatgcagccagctggcaagggaaggggtggattccttccatttctat
accatgaatcgagctgaaattacctctgccctttgtcgccttttaggcagacaacctgtg
gcctga

DBGET integrated database retrieval system