KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1755
Entry
ZMO1755           CDS       T00221                                 

Definition
(GenBank) Thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00240  Pyrimidine metabolism
zmo00670  One carbon pool by folate
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ZMO1755
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ZMO1755
Enzymes [BR:zmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     ZMO1755
SSDB
Motif
Pfam: Thymidylat_synt
Other DBs
NCBI-ProteinID: AAV90379
UniProt: Q9Z671
Position
complement(1798411..1799301)
AA seq 296 aa
MSEHQYLRLVSDILEKGDQRHDRTGVGTLSLFGAMMRFDLSKGRIPILTTKKVSYRLAIR
EMLWFLSGDTNIRPLVEQGVSIWSDWPLARYQAETGALLSKKEFEAKILADTEFAKKWGD
LGPVYGRQWRRWQGSDGQVYDQIATLIETLKSNPSSRRMLFHGWNVAELKDMALPPCHMV
YQYHVTSDGRLNSLLYQRSADVFLGLPFNLVGAAALQAMLADQAGLALGDLVWTGGDVHI
YRNHIDQMKEQLAREPRAFPRLELTRHPNSITDYKIEDFAITGYDPHPPIKGAVAV
NT seq 891 nt   +upstreamnt  +downstreamnt
ttgtcggaacatcaatatcttcgcctcgtctcggatattctggaaaaaggcgatcagcgt
catgatcgcaccggagtcggaacgctgtctttgtttggtgcgatgatgcggttcgatctt
tccaaaggtcggataccgattctaacgactaaaaaagtatcttatcgtttggctattcgc
gaaatgctgtggtttctttccggcgacaccaatattcgacctttggttgagcaaggcgtt
tcgatatggagcgattggccattggcacgttatcaggcagaaactggcgcgttgctttcc
aagaaagaatttgaagcaaagattcttgccgatacagaatttgctaaaaaatggggcgat
ctaggccccgtctatggtcggcagtggcggcgatggcaggggagtgacgggcaggtttat
gaccaaatagcgaccttgattgaaactctgaaaagcaatccctctagtcgccggatgctt
ttccacggctggaatgtcgctgaattaaaagatatggccttgccgccttgccatatggtc
tatcaatatcatgtgacatccgatggtcgattaaacagtcttctttatcaaagaagtgcg
gatgtctttttggggctgcctttcaatttggtaggcgcggcagcgttgcaagcgatgctt
gctgatcaagctggattggctttaggcgatctggtgtggacgggcggtgatgttcatatc
tatcgtaatcatatcgaccagatgaaagaacagcttgcccgtgaacctcgggcttttccc
cgtttagaattaacgcgccatcccaacagcattacagattataaaatcgaggattttgcg
attacaggatatgatcctcatccccctatcaagggcgcggttgcggtttga

DBGET integrated database retrieval system