KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0197Help
Entry
Zymop_0197        CDS       T01556                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00450  Selenocompound metabolism
zmp00970  Aminoacyl-tRNA biosynthesis
zmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Zymop_0197
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Zymop_0197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zmp01007]
    Zymop_0197
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zmp03016]
    Zymop_0197
Enzymes [BR:zmp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Zymop_0197
Amino acid related enzymes [BR:zmp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Zymop_0197
Transfer RNA biogenesis [BR:zmp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Zymop_0197
 Prokaryotic type
   Other AARSs
    Zymop_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEI37100
UniProt: F8EU20
Position
complement(230268..231848)
Genome map
AA seq 526 aa AA seqDB search
MSQSFYITTAISYPNGKPHIGHAYEAIAADALARYHRLLGQDVYFQTGTDEHGLKMDQAA
RNRDVKPITLADEMSSHFKAMDDLYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLG
RYEGWYSVRDEAFYKEDELITDAAGNKLSPQGTPVEWNVEESWFFRLSDFQDKLLAYYEA
HPKFIQPEARRNEVISFVKSGLSDLSISRSSFDWGIPVPDAPGHVMYVWIDALTNYLTGA
GYPDNQARLEHYWPADIHIIGKDIIRFHAVYWPAFLMAANIPLPKAVFGHGFLLNKGEKM
SKSVGNVVDPIDMAKLYGVDQLRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQ
RSLSMIAKNGAKVPTPYKTTAADETLMTKLAGIPHQVATAMNNIAPNQALDAIWRGVAEA
NLYISEQAPWTVRKTDPERADTILYWTAEAVRQLAILSRWAIPNSSDALLDQLGQGADQR
DFAALSSPLVPSLALPAPQGVFPRFIDEDKVSSDKKNAKKTAKDKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatctttttatattacgactgctattagctatcccaatggcaaaccccatatt
ggtcacgcttatgaagctatcgcggctgatgcgcttgcccgctatcatcgtcttttagga
caggatgtctatttccaaacgggtactgatgaacatggtctaaaaatggatcaggcggcg
cgtaaccgtgatgttaaaccgattacccttgcagatgagatgtcttctcattttaaagct
atggatgatctttataatatttcttatgatcgctttattaggaccacagaagctgaacat
tataaggcaagtcaagccttgtggaaaactttagccgatgcagggcatatttatctggga
cgctatgaaggatggtattctgtccgagacgaagccttttataaagaagatgagctgatt
actgacgcagctggtaataaattatccccgcaagggacacccgttgaatggaatgtagaa
gaaagctggttctttagactttctgactttcaagataaattgctagcttattatgaagcg
caccctaaatttattcaaccggaagcccggcggaatgaagttatcagttttgtaaaatct
ggcttgtctgatctttctatttcacggagcagctttgattggggcattcctgtaccggat
gcgccaggacatgtcatgtatgtctggattgatgcgttaacgaattatctgacaggggca
gggtatcctgataatcaagccagacttgaacactattggccagcggacattcatattatc
ggtaaagatattatccgttttcatgctgtttactggcctgcttttttaatggcagcgaat
attcctttaccaaaggccgtttttggtcacggatttctccttaataaaggagaaaaaatg
tctaaatctgttggaaatgttgtcgatccaatagatatggctaaactttatggcgtagac
cagcttcgctatttcctgttacgagaagtgacttttggtcaggatggcagctatagtcat
gaagcaattgttaatcgtattaatgccgacttggcgaatgatttcggcaatctagcccaa
cgatcattatcaatgatcgcaaagaatggcgcaaaagttccaacgccttataagacgacg
gcggctgacgaaaccttgatgaccaaactggcgggtatccctcatcaggtggccacagct
atgaataatatcgcgcctaatcaggccttggatgctatctggcgtggtgttgctgaagct
aatctttatatttcagaacaagctccgtggacggtcagaaaaaccgatcctgaacgtgca
gataccattctttattggacagccgaggcagttcgtcagctcgccattttaagtcggtgg
gctattccgaacagtagtgatgctttattagatcaattagggcagggggcagatcagcga
gatttcgcggctttatcatcgccgttggtgccttccttggcactacctgcgccacaaggt
gtttttccccgttttatagatgaagataaagtctcatctgacaagaaaaacgctaaaaaa
acagctaaggataaagcctaa

DBGET integrated database retrieval system